KEGG   Spirochaeta africana: Spiaf_2367Help
Entry
Spiaf_2367        CDS       T01811                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sfc  Spirochaeta africana
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spiaf_2367
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spiaf_2367
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spiaf_2367
Enzymes [BR:sfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spiaf_2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2681067..2682302
Genome map
AA seq 411 aa AA seqDB search
MSNQTRQDYFKSVPDAQGNFGQFGGSYIPPELQQEMDRITDAYYSISKSHQFISELRSIR
THFQGRPTPVYFARTLSDELGGRIYLKREDLNHTGAHKLNHCMGEALLAKYMGKKKLIAE
TGAGQHGVALATAAAYFGLECEIHMGEVDIAKEHPNVVRMQILGAKVVPVSFGLKTLKEA
VDSAFAAYLEDPVTSIYCIGSVVGPHPFPMMVRDFQRVVGIESREQFFEMTGENPDNVVA
CVGGGSNAMGIFSGFLDLEETRLYGVEPMGRGTTIGEHAATMTYGRPGVIHGFKCYLLQD
DAGEPAPVYSIASGLDYPGVGPEHSMLKESGRVTYDSVTDQETVDAFFELSRKEGIIPAL
ESAHAVAYAMKLAKDNPRQSILVNLSGRGDKDIDFIVEQYGTRATFADAVE
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcaaaccagacaggattactttaaatcagtgccggatgcccagggtaacttc
gggcagttcggtggcagctatatcccgcccgagctgcagcaggagatggaccggatcacc
gatgcctactactccatcagcaagtcgcaccagtttatctctgagctgcgcagcatccgg
acacatttccaggggcggccgacaccggtctattttgcccgcaccctgagcgacgagctg
ggcggccggatctacctgaagcgcgaggatctgaaccacaccggtgcccacaagctgaac
cactgcatgggcgaggccctgctggccaagtacatgggcaagaaaaagctgattgccgag
accggtgccgggcagcacggggttgccctggccaccgccgcagcctatttcgggctcgag
tgcgagatccacatgggcgaggtggacatcgccaaggagcatccgaatgtggtacggatg
cagatcctgggtgccaaggtagtgccggtttccttcggactgaagaccctgaaagaggcg
gtggactcggcctttgccgcctacctggaggatccggtcacctccatctactgtatcggt
tcggtcgtcggcccccaccccttcccgatgatggtgcgcgacttccagcgcgtggtcggg
attgaatcgcgtgagcagttcttcgagatgaccggcgaaaacccggacaacgtcgttgcc
tgcgtgggcggcggcagcaatgccatgggtatcttctcgggatttctggatctggaagag
acacggctgtacggtgtcgagccgatggggcgcgggacaacgattggtgagcatgccgcg
accatgacctacggcagacccggggtgattcacggctttaagtgctacctgctgcaggat
gatgccggcgaaccggcgccagtctattccatcgccagcgggctggactaccccggtgtc
ggaccggagcactcgatgctcaaggaaagcggacgggtaacctacgactcggtaaccgac
caggagaccgtggacgccttcttcgagctcagccgcaaggaagggatcatcccggccctg
gagagcgcccatgccgttgcctacgcaatgaagctggccaaggataatccccgccagtcg
atcctggtgaacctgagcggccgcggcgacaaggacatcgattttattgtggagcagtac
ggcacccgggccacatttgccgatgcggtagagtaa

DBGET integrated database retrieval system