KEGG   Spirochaeta africana: Spiaf_2367Help
Entry
Spiaf_2367        CDS       T01811                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sfc  Spirochaeta africana
Pathway
sfc00260  Glycine, serine and threonine metabolism
sfc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sfc01100  Metabolic pathways
sfc01110  Biosynthesis of secondary metabolites
sfc01130  Biosynthesis of antibiotics
sfc01230  Biosynthesis of amino acids
Module
sfc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spiaf_2367
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spiaf_2367
Enzymes [BR:sfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spiaf_2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFG38399
UniProt: H9ULK6
Position
2681067..2682302
Genome map
AA seq 411 aa AA seqDB search
MSNQTRQDYFKSVPDAQGNFGQFGGSYIPPELQQEMDRITDAYYSISKSHQFISELRSIR
THFQGRPTPVYFARTLSDELGGRIYLKREDLNHTGAHKLNHCMGEALLAKYMGKKKLIAE
TGAGQHGVALATAAAYFGLECEIHMGEVDIAKEHPNVVRMQILGAKVVPVSFGLKTLKEA
VDSAFAAYLEDPVTSIYCIGSVVGPHPFPMMVRDFQRVVGIESREQFFEMTGENPDNVVA
CVGGGSNAMGIFSGFLDLEETRLYGVEPMGRGTTIGEHAATMTYGRPGVIHGFKCYLLQD
DAGEPAPVYSIASGLDYPGVGPEHSMLKESGRVTYDSVTDQETVDAFFELSRKEGIIPAL
ESAHAVAYAMKLAKDNPRQSILVNLSGRGDKDIDFIVEQYGTRATFADAVE
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcaaaccagacaggattactttaaatcagtgccggatgcccagggtaacttc
gggcagttcggtggcagctatatcccgcccgagctgcagcaggagatggaccggatcacc
gatgcctactactccatcagcaagtcgcaccagtttatctctgagctgcgcagcatccgg
acacatttccaggggcggccgacaccggtctattttgcccgcaccctgagcgacgagctg
ggcggccggatctacctgaagcgcgaggatctgaaccacaccggtgcccacaagctgaac
cactgcatgggcgaggccctgctggccaagtacatgggcaagaaaaagctgattgccgag
accggtgccgggcagcacggggttgccctggccaccgccgcagcctatttcgggctcgag
tgcgagatccacatgggcgaggtggacatcgccaaggagcatccgaatgtggtacggatg
cagatcctgggtgccaaggtagtgccggtttccttcggactgaagaccctgaaagaggcg
gtggactcggcctttgccgcctacctggaggatccggtcacctccatctactgtatcggt
tcggtcgtcggcccccaccccttcccgatgatggtgcgcgacttccagcgcgtggtcggg
attgaatcgcgtgagcagttcttcgagatgaccggcgaaaacccggacaacgtcgttgcc
tgcgtgggcggcggcagcaatgccatgggtatcttctcgggatttctggatctggaagag
acacggctgtacggtgtcgagccgatggggcgcgggacaacgattggtgagcatgccgcg
accatgacctacggcagacccggggtgattcacggctttaagtgctacctgctgcaggat
gatgccggcgaaccggcgccagtctattccatcgccagcgggctggactaccccggtgtc
ggaccggagcactcgatgctcaaggaaagcggacgggtaacctacgactcggtaaccgac
caggagaccgtggacgccttcttcgagctcagccgcaaggaagggatcatcccggccctg
gagagcgcccatgccgttgcctacgcaatgaagctggccaaggataatccccgccagtcg
atcctggtgaacctgagcggccgcggcgacaaggacatcgattttattgtggagcagtac
ggcacccgggccacatttgccgatgcggtagagtaa

DBGET integrated database retrieval system