KEGG   Spirochaeta africana: Spiaf_2678Help
Entry
Spiaf_2678        CDS       T01811                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sfc  Spirochaeta africana
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Spiaf_2678
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Spiaf_2678
Enzymes [BR:sfc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Spiaf_2678
Two-component system [BR:sfc02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Spiaf_2678
Bacterial motility proteins [BR:sfc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Spiaf_2678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3065042..3066325
Genome map
AA seq 427 aa AA seqDB search
MDTISVLVVDDSALMRNLITRMIEQSPDMKVVGKAMNGDFALQKIPILKPDIIILDLEMP
KMNGLEFLEARRKQGIDVPVIILSSIARKGAKVTMDALAMGAADFVTKPSGSISTDIHVV
ADQVQALIRAYGGKYARSIGKTIPDPPVGNAETQAGYREAPPAEHISTEKPAPPRTPAAD
SPAAPPPRQLNRAVEAPRGLEPLQPGTLPKQIDLIVIGISTGGPNALRKMFAAISRDLPV
PIVVVQHMPAGFTYEFAKSLDRICPLVVKEAEDGEDLKPGHIYIAPGDTHVQVHAPGSPG
GSGASGASDDDPGATGSSRSMGTIRLNREAPENGHRPSADVLFRSAAKQFGNRCLAVIMT
GMGRDGAREIGTLYANGAATIGQDPGSCVVYGMPKVAYDAGYLYQQVPLSHMADTIAAIT
ADPQSLA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggacaccatttccgtactggttgttgacgactctgccctgatgcggaatctgatcacc
cgaatgatagaacagtcgccggacatgaaggtcgtcggcaaagccatgaacggggatttc
gccctgcagaagattccgatcctgaagccggacatcattatcctggacctcgagatgcca
aagatgaacgggctcgagttcctcgaagcccgacgcaaacaaggaatcgatgtaccggta
ataattttgtcttccatcgctcgtaagggggccaaggttaccatggacgcactggccatg
ggtgccgccgattttgttaccaaaccttccggctcaatctcgaccgatattcatgtagta
gccgaccaggtacaggccctcatccgggcttatggcgggaagtacgcccgctcgatcggc
aaaaccattcccgaccccccggtcgggaatgcggaaacccaggccggctaccgggaagcc
ccgccagccgaacacatctccacggaaaaaccagcgcccccccgcaccccggcagcagac
agccccgccgcacctcccccgcggcagcttaaccgcgcagtggaagccccgcgcgggctt
gaaccgctgcaacccggtacgctgcccaaacagatcgacctgattgtaatcggtatctcg
accgggggaccgaacgccctgcgcaagatgtttgccgccatcagtcgtgatctgccggtg
ccgatcgtggttgtgcagcatatgccggccgggttcacctatgagtttgccaaaagtctg
gatcgcatctgtccgctggtggtaaaagaggccgaggatggcgaggatctgaagcccggc
cacatatacatcgcccccggcgacacccatgtgcaggtgcatgcacccggcagcccgggc
ggctccggcgcttcgggagcttccgatgatgaccccggtgctactggcagctcccgcagc
atggggaccatccgcctgaaccgtgaagccccggaaaacggccaccgcccctctgctgac
gtcctgttccgatccgctgccaaacagtttggcaaccgctgcctcgcggtaatcatgacc
ggcatgggccgggacggcgcccgggaaatcggcaccctgtacgccaacggtgcagctacc
atcggacaggatcccggctcctgcgtggtatacggcatgcccaaggtcgcctacgacgcc
gggtatctgtatcagcaggtaccgctttctcatatggccgacaccatcgctgctattacc
gccgacccgcagtcgctggcctga

DBGET integrated database retrieval system