KEGG   Spirochaeta africana: Spiaf_2765Help
Entry
Spiaf_2765        CDS       T01811                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sfc  Spirochaeta africana
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sfc00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sfc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3168090..3169382
Genome map
AA seq 430 aa AA seqDB search
MHTYVVDGSFPIKGTVRASGNKNAALPCIAAALLSEEEVVLRNIPDIEDVRVLMDILRAI
GATAENPEQGVWRVKASSISTHEIPAQLARRVRASILLAGPMLARTGKVILPPPGGDVIG
RRRLDTHFLALSGLGARIEYDAFFTMTANKLVGLPLFLDEASVTATENAIMAASLAEGET
VIENCASEPHVQDLCNMLNAMGAKISGIGSNILRITGVKKLHGTDFAIGTDFMEVGSLIG
MAAVTRGELEIQQAAPHNLKMVKIGFQKLGIHWETDGSSIFVPSRQKLAVQNDLGGAVPK
IDDAPWPGFPPDLTSIMTVVATQVAGTILIHEKMFESRMFFVDKLIGMGAQIILCDPHRA
VVSGPARLTGSVLVSPDVRAGMAMLIAAMCAEGQSEIHNVYQIERGYERLVERLSSIGAR
IERRAESTES
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcacacttatgtagtagatggcagctttccgatcaagggaaccgtacgagccagcggc
aacaagaacgccgcactcccctgtatagccgcagccctcctttccgaggaagaggttgtc
cttcgcaatatccccgatatcgaagacgtccgcgtacttatggacattcttcgggcaatc
ggtgccaccgccgaaaacccggagcagggtgtctggcgagtcaaggcatccagtatctct
acccacgagatcccggcacagctggcacgccgggtacgggcatcaatactgcttgccggc
cccatgctggcacgtaccggcaaggtcatcctgcccccgccgggcggagatgtcattggg
cgccgccgcctggacacccatttcctggcattgtccggcctcggggcaaggatcgagtac
gatgcctttttcaccatgaccgccaacaaactggtaggcctccctctcttcctggatgag
gcatcggtaaccgcaaccgaaaacgccatcatggctgcctcgcttgccgagggtgaaacc
gtgatcgagaactgtgccagtgagccacatgtccaggatctgtgtaacatgctgaacgcg
atgggggccaaaatcagcggaatcggatcgaatatcctccgcatcaccggggtaaagaaa
ctgcatggaaccgactttgcgatcggcaccgacttcatggaggttggctcgctgataggc
atggcagcggttacccgtggcgaactggagatccagcaggctgcaccccacaacctcaag
atggtcaaaatcggattccagaagcttggaatacactgggaaaccgatgggtcctcgata
tttgtcccctcgcggcagaagctggcggtgcagaatgaccttggcggcgcggttcccaag
atcgacgacgcgccatggccgggcttccccccggatctgaccagtatcatgaccgtggtt
gctacccaggtcgccggtaccatcctgatccacgaaaaaatgtttgaatccagaatgttt
ttcgtagacaaactgatcggcatgggagcccagattattctgtgcgatccgcatcgcgcg
gtggtatccggtcccgcccggcttaccggctctgtgctggtatctccggacgtacgtgcc
ggcatggccatgctgatcgccgcaatgtgcgccgaaggccagagtgagatccacaatgtg
tatcagattgagcgtggttacgaacgattggtcgagcgactgtcatccattggtgctcgc
atcgaacgccgcgccgaaagcaccgagtcatag

DBGET integrated database retrieval system