KEGG   Spirochaeta africana: Spiaf_2860Help
Entry
Spiaf_2860        CDS       T01811                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sfc  Spirochaeta africana
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Spiaf_2860
DNA repair and recombination proteins [BR:sfc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Spiaf_2860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3274057..3274647)
Genome map
AA seq 196 aa AA seqDB search
MTSLDQLVRLLAKLPGIGRKSATRMAYHILNSDSDYADSLAHYITEMRERIKPCSVCGSY
TEVDPCDICTDQRRDHSMVCVVETAQDVAVLESARVFPGIYHVLGGVISPIDGVGPDDIR
IPRLLERIGEGQIREVVLATNPTVEGDTTALYIARQIEGIEGVTTTRLALGLPVGGDLEY
VDRMTLERSLRGRTQV
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcctcgaccagctggttcgtctgctggccaaactgccgggcatcggacgaaaa
agcgccactcgcatggcgtatcatatcctcaacagcgacagcgactatgccgattcactt
gcgcactacataaccgagatgcgggaacggatcaaaccctgctcggtatgcgggagctat
accgaggttgatccgtgcgatatctgtaccgatcagcgtcgtgatcattcgatggtgtgc
gtggtagagactgcccaggatgtcgcggtgctggaatcggcccgggtttttcccggcata
tatcatgtccttggcggggttatctccccgatcgacggtgtcggtccggatgatatccgg
attccgcgcttgctggagcggatcggcgagggacagatccgcgaggttgtgctggcaacc
aatccgacggtggagggcgacacgacagccctgtatattgcccgccagatagaggggatc
gaaggggttaccacaacacgacttgccttggggcttccggtcgggggtgacctggagtat
gtagaccggatgaccctggagcgttccctgcggggacggacacaggtgtag

DBGET integrated database retrieval system