KEGG   Sinorhizobium fredii USDA 257: USDA257_c00550Help
Entry
USDA257_c00550    CDS       T02188                                 

Gene name
rbsK1
Definition
ribokinase RbsK (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    USDA257_c00550 (rbsK1)
Enzymes [BR:sfd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     USDA257_c00550 (rbsK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(57272..58171)
Genome map
AA seq 299 aa AA seqDB search
MITVFGSINVDLIATTARLPKPGETVAGTGFSTAAGGKGANQALAARRAGASVRMAGAVG
SDSFAEGALALLKAAGTDLGLTKTVGAPTGTAHILVGGDGENVIVVVASANATVSEGDAV
SAVEQMSAGDTLMLQLEIPAASVEKALVEAKRRGIRSIINIAPLTPEAARLGRMADIVIA
NETEFELLAGRSGIAGAEREAAIKGLHDETGQTVIVTLGAEGVAAAHQGEIHRARGLAIE
PVDTVGAGDTFCGYLAASLDAGLAFPDALRRAAVAGSLACLKAGAQPSIPLDSEVAARL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgtctttgggtccatcaacgtggacctgatcgccacgaccgcacgccttccg
aagcccggcgaaaccgtcgccggaacgggcttttccaccgccgccggcggcaagggcgca
aaccaggcgctggcagcccgtcgcgccggtgcttctgtccgcatggccggcgccgtcggc
tcggacagcttcgcggaaggcgcgcttgccctgctcaaggctgctggcaccgaccttggc
ctcaccaagaccgtcggcgcaccgaccgggaccgcgcatatcctggtcggcggcgatggc
gagaacgtcatcgtcgtcgtcgccagcgccaatgccacggtgagcgagggcgacgcggtt
tccgccgtcgagcagatgtcggccggcgacacgctgatgctgcagctcgaaattcccgct
gcctcggtggaaaaggcgctcgtagaggcaaaacgccgcggcatccgctcgatcattaat
atcgcgccgctgacgccggaggccgcccgcctcggccgcatggccgatatcgtgatcgcc
aacgagaccgagtttgagctgctcgcgggcagaagcgggatcgccggcgccgaacgggaa
gcggcgataaaaggcctccacgatgaaaccggacaaaccgtcatcgtcacgctcggcgcc
gaaggggttgccgccgcccatcagggcgaaatccatcgcgccagggggctggccattgag
ccggtcgacactgtcggggccggcgatacgttctgcggctatctcgcggccagcctggac
gcgggcctcgccttccccgatgcgctgcgccgcgccgcggttgccgggtcgctcgcctgc
ctgaaagcgggagcgcagccgtccataccgctcgactccgaggtcgccgcgcgtctttga

DBGET integrated database retrieval system