KEGG   Sinorhizobium fredii USDA 257: USDA257_c01470Help
Entry
USDA257_c01470    CDS       T02188                                 

Gene name
fadJ
Definition
fatty acid oxidation complex subunit alpha (EC:4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    USDA257_c01470 (fadJ)
   01212 Fatty acid metabolism
    USDA257_c01470 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    USDA257_c01470 (fadJ)
   00650 Butanoate metabolism
    USDA257_c01470 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    USDA257_c01470 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    USDA257_c01470 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    USDA257_c01470 (fadJ)
   00310 Lysine degradation
    USDA257_c01470 (fadJ)
   00380 Tryptophan metabolism
    USDA257_c01470 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    USDA257_c01470 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    USDA257_c01470 (fadJ)
   00281 Geraniol degradation
    USDA257_c01470 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    USDA257_c01470 (fadJ)
Enzymes [BR:sfd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     USDA257_c01470 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     USDA257_c01470 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     USDA257_c01470 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(156194..158407)
Genome map
AA seq 737 aa AA seqDB search
MSYTNFKIETDADGIALVTWDMPDKSMNVLTEEVMDELDAIVDQTTADAAVKGIVFTSGK
SSFSGGADLSMIKSMFTLQTEEKKKDPANAAQKLFNLVGRMTGLFRKLETSGKPWVSAIN
GTCMGGAFELSLACHGRVASNSKSVKIGLPEVKVGIFPGAGGTQRVPRLTNTQDALQMMT
TGSSLTAARAKAMGLVHEVVDPDKLVDAAKAMIKNGLKAVQPWDEKGFKLPGGGVWTPAS
AQLWPAASAILRRETYGNYPGAIAILKCVYEGLQVPFDTGLKIEQRYFTEILQTTEAFSM
MRSLFISMQELGKGARRPAGVAKTELKRVGVVGAGFMGASIAYVTAAAGNPVTLIDRDME
AAEKGKAHSEGLVKDAIGKGRLTKEEGEALLARISPSADYNDLKEVGLVVEAVFEDRQVK
KDVIEKVEAVIGEDAIFASNTSTLPITGLAKNSKRPEQFIGVHFFSPVEKMMLTEVIVGK
ETGDKALATALDYVAAIKKTPIVVNDTRGFYVNRCVFRYIHEAYDMLIEGVPPAMIENAA
KMAGMPVGPLSLNDEVAIDLSQKILKATVADLGEKAVDPRHMALVNKLVDELDRRGRKNG
KGFYEYPAKPAKKYLWPELKTLYPQKAADKVDVEVLKQRFLATMALEAARTIEEGIVTDP
READVGSILGFGFAPYTGGTLSYIDGMGARAFVAMCNKLAEDYGDHFKPTPLLKEMAEKG
ETFYGRFDPYGQAQKAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacacgaacttcaagatcgaaaccgacgccgacggcatcgcactcgtcacctgg
gacatgcccgacaagtcgatgaacgttctcactgaggaggtgatggacgaactggatgcg
atcgtcgaccagacgaccgccgatgccgccgtcaagggcatcgtcttcacctccggcaag
tcgtccttctccggcggcgccgacctctcgatgatcaagtcgatgttcacgctgcagacc
gaggagaagaagaaggatccggcaaacgccgcgcagaagctcttcaacctcgtcggccgc
atgacggggctgttccgcaagctcgaaacctcaggcaagccctgggtctcggcgatcaat
ggcacctgcatgggcggcgccttcgaactgtcgctcgcctgccacggccgcgtcgcttcc
aattcgaaatcggtcaagatcgggctccctgaggtcaaggtcggtatcttcccgggtgcc
ggtggcacgcaacgcgtgccgcggctcaccaacacgcaggacgcgctgcagatgatgacc
accggctcgtcgctgaccgcggcgcgcgccaaggccatggggctggtgcacgaggtggtc
gatccggacaagctggtcgacgccgccaaggcgatgatcaagaatgggctcaaagcggtg
cagccttgggacgagaagggcttcaagcttccgggcggcggcgtctggacccccgcttcc
gcgcagctctggccggcggcctccgccattctccgccgtgaaacctatggcaactatccg
ggcgcgatcgccatcctgaaatgcgtctatgaaggcctgcaggtcccgttcgacacgggc
ttgaagatcgagcaacgctatttcaccgagatcctgcagaccaccgaagccttttcgatg
atgcgctcgctattcatctcgatgcaggagctcggcaagggcgcccgccgcccggccggc
gtagcgaagacggagctcaagagggtcggcgtcgtcggtgcaggattcatgggcgcctcg
atcgcctatgtgaccgccgccgccggcaatccggtcaccctcatcgaccgcgacatggaa
gcggccgaaaagggcaaggctcattcggaaggcctggtcaaggacgcgatcggcaaaggc
cgcctgaccaaggaagaaggtgaggcgctcctcgcccgcatctcgccttcggccgactac
aacgacctcaaggaggtcggcctcgtcgtcgaagccgtgttcgaagaccgccaggtcaag
aaggacgtgatcgaaaaggtggaagcggtgatcggcgaggatgccatttttgcgtcgaac
acctcgacgttgccgatcacgggccttgcaaagaactcgaagcgaccggagcagttcatc
ggcgtccatttcttttcgccggtcgaaaagatgatgctgacggaagtgatcgtcggcaag
gagaccggcgacaaggcactcgccacggcgctcgactatgtcgccgcgatcaagaagacg
ccgatcgtcgtcaacgacacgcgcggcttctacgtcaaccgctgcgtcttccgctacatc
cacgaagcctacgacatgctgatcgagggcgtgccgccggcgatgatcgaaaacgccgcc
aagatggccggcatgccggtcgggccgctgtcgctcaacgacgaggtggcgatcgacctc
agccagaagatcctcaaggcgacggtcgccgatctcggcgaaaaggcggtcgatccgcgc
catatggctctggtcaacaagctcgtcgacgaactcgaccggcgcggccgcaagaacggc
aagggcttctacgaatacccggcgaaaccggcgaagaagtatctgtggccggagctgaag
acgctctatccgcagaaggcggccgacaaggtcgacgtggaggtgctgaagcagcgcttc
ctcgcaacgatggcgctcgaagcggcccgcaccatcgaggaaggcatcgtcaccgatccg
cgcgaggcggatgtcggctcgatcctcggcttcggcttcgcgccctacaccggcggcacg
ctctcctatatcgacggcatgggcgccagggccttcgtcgcgatgtgcaacaagctggcc
gaggactatggcgaccacttcaagccgacgccgctcttgaaggagatggccgaaaagggc
gagaccttctacggacgcttcgatccctacgggcaggcgcagaaggcggcttaa

DBGET integrated database retrieval system