KEGG   Sinorhizobium fredii USDA 257: USDA257_c01920Help
Entry
USDA257_c01920    CDS       T02188                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase PncA (EC:3.5.1.- 3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    USDA257_c01920 (pncA)
Enzymes [BR:sfd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     USDA257_c01920 (pncA)
    3.5.1.-  
     USDA257_c01920 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
216548..217147
Genome map
AA seq 199 aa AA seqDB search
MAEDALIVIDMQNDFCPGGALAVEDGDEVVPIVNRLIEGARHVILTQDWHPAGHSSFASS
HPGKAPFQTVTMPYGEQTLWPDHCVQGSPGADFHPALRWTTAELIVRKGFRTEIDSYSAF
FENDHRTPTGLAGYLHERGISKVTLCGLATDFCVAYSALDAVAQGFSTSVVLGACRGIDL
NGSLAAMTGRMREAGVELL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagatgccctgatcgtcatcgacatgcaaaatgacttctgcccgggcggcgcg
ctcgcggtcgaggatggcgatgaagtcgtgccgatcgtcaaccgcctcatcgaaggggcc
cggcacgtcatcctgacgcaggactggcacccggccggccattcgagcttcgcgtcgagc
catcccggcaaggcgcctttccagacggtgacgatgccctatggcgagcagacgctttgg
cccgatcattgcgtccagggcagcccgggcgccgattttcaccccgctttgcggtggacg
acggcggaactgatcgtgcgcaaggggttccgcaccgaaatcgacagctattcggccttc
ttcgagaacgaccaccggaccccgacgggcctcgccggctatttgcacgagcgtggaata
tccaaggtgaccctctgcggtctggcaaccgatttctgcgtcgcctactcggcgctcgat
gcagtcgcccagggtttttcgacctccgtcgtgctcggcgcctgtcgcggcatcgatctc
aacggatcgcttgccgcgatgactgggcgtatgcgcgaggcgggcgtcgagttgctctag

DBGET integrated database retrieval system