KEGG   Sinorhizobium fredii USDA 257: USDA257_c06400Help
Entry
USDA257_c06400    CDS       T02188                                 

Gene name
thrC
Definition
threonine synthase ThrC (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    USDA257_c06400 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    USDA257_c06400 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    USDA257_c06400 (thrC)
Enzymes [BR:sfd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     USDA257_c06400 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(690577..691974)
Genome map
AA seq 465 aa AA seqDB search
MKYISTRGEAAPLGFCDALLAGLARDGGLYLPKEWPTFSKKEIRALRGKSYQEIAFAVLE
PFTNGEILAAKFREMIDEAYATFRHPAIAPLVQTGPNSFVMELFHGSTLAFKDVAMQLLA
RLMDHVLAERGERATIVGATSGDTGGAAIDAFAGRERTDIFILFPHGKVSPVQQRQMTTA
GASNVHAIAIKGNFDDCQNLVKAMFNDTAFRDRVKLSGVNSINWARIMAQIVYYFTTAIA
LGGPDRRISFTVPTGNFGDIFAGYVAKRMGLPVDKLIIATNENDILARTLKTGRYEMREV
KATTSPSMDIQISSNFERLLFEVYGREAEGVRAAMASLKQSGSFAIAEGALKKIRKEFRA
GRASEKQVAATIRDTFEKSGYLLDPHTAIGVCVAARHEKPSAPMVTLGTAHPAKFPDAVK
SASGIDPTLPTWLADLMTGAERFDILDAELKKVETFIGERTRVRE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtatatttcgacgcgtggggaagcagcacccctcggcttctgcgacgctcttctg
gcaggacttgcccgtgacggtggtctctacctgccgaaggaatggccgaccttctcgaag
aaggaaatccgggcgctgcgcggcaaatcctatcaggaaatcgctttcgccgttctcgaa
cccttcacgaatggcgaaatcttggcggccaagttccgcgagatgatcgacgaggcctac
gccaccttccgccatccggccattgcaccgctcgtccagaccggccccaactctttcgtc
atggaactcttccacggttcgacgctcgccttcaaggacgtcgccatgcaattgctggcc
cgcctcatggaccatgtgcttgccgagcgcggcgaacgggcgacgatcgtcggggcgacc
tccggagatacgggaggagccgcgatcgacgcttttgccggtcgggaacggaccgacatc
ttcatcctcttcccgcacggcaaggtctcgccggtacagcagaggcagatgacgaccgcg
ggcgcatcgaacgtgcatgcgatcgccatcaagggaaatttcgacgattgccagaatctc
gtcaaagcgatgttcaacgacacggcctttcgcgaccgcgtcaagctctcgggcgtcaac
tcgatcaactgggcgcgcatcatggcgcagatcgtctattacttcacgacggcaatcgcg
cttggcggccctgaccggaggatttccttcacggtgccgaccggcaatttcggcgacatc
ttcgccggctatgtcgccaaacgcatgggcctgccggtcgacaagctgatcatcgcgacc
aacgagaacgacattctggcgcgcacgctgaagaccggccgctacgagatgcgcgaggtc
aaggcgacgacctcgccctcgatggacattcagatctcatccaacttcgaacggctgctg
ttcgaggtctatgggcgcgaggctgaaggggtgcgcgccgcaatggcaagcctcaagcaa
tccggatcctttgcaatcgcagagggcgcactaaaaaaaattcgcaaggaatttcgcgcc
ggccgcgcctcggaaaagcaggtggccgcaacgatccgcgacacgttcgagaaatcgggc
tatctccttgatccgcatacggcaatcggcgtctgcgtcgccgccaggcacgagaagcca
tcggcaccgatggtaacgctcgggaccgcccaccccgcgaaatttcccgacgccgtaaaa
tcggcaagtggtattgaccccacgcttccgacgtggcttgctgatctcatgactggggcg
gagcgtttcgatatcctggatgctgagctgaaaaaggtcgaaaccttcatcggcgagcgt
acccgcgttcgggaatag

DBGET integrated database retrieval system