KEGG   Sinorhizobium fredii USDA 257: USDA257_c06400Help
Entry
USDA257_c06400    CDS       T02188                                 

Gene name
thrC
Definition
(GenBank) threonine synthase ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00260  Glycine, serine and threonine metabolism
sfd00750  Vitamin B6 metabolism
sfd01100  Metabolic pathways
sfd01110  Biosynthesis of secondary metabolites
sfd01120  Microbial metabolism in diverse environments
sfd01230  Biosynthesis of amino acids
Module
sfd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    USDA257_c06400 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    USDA257_c06400 (thrC)
Enzymes [BR:sfd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     USDA257_c06400 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AFL49235
UniProt: I3X029
Position
complement(690577..691974)
Genome map
AA seq 465 aa AA seqDB search
MKYISTRGEAAPLGFCDALLAGLARDGGLYLPKEWPTFSKKEIRALRGKSYQEIAFAVLE
PFTNGEILAAKFREMIDEAYATFRHPAIAPLVQTGPNSFVMELFHGSTLAFKDVAMQLLA
RLMDHVLAERGERATIVGATSGDTGGAAIDAFAGRERTDIFILFPHGKVSPVQQRQMTTA
GASNVHAIAIKGNFDDCQNLVKAMFNDTAFRDRVKLSGVNSINWARIMAQIVYYFTTAIA
LGGPDRRISFTVPTGNFGDIFAGYVAKRMGLPVDKLIIATNENDILARTLKTGRYEMREV
KATTSPSMDIQISSNFERLLFEVYGREAEGVRAAMASLKQSGSFAIAEGALKKIRKEFRA
GRASEKQVAATIRDTFEKSGYLLDPHTAIGVCVAARHEKPSAPMVTLGTAHPAKFPDAVK
SASGIDPTLPTWLADLMTGAERFDILDAELKKVETFIGERTRVRE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtatatttcgacgcgtggggaagcagcacccctcggcttctgcgacgctcttctg
gcaggacttgcccgtgacggtggtctctacctgccgaaggaatggccgaccttctcgaag
aaggaaatccgggcgctgcgcggcaaatcctatcaggaaatcgctttcgccgttctcgaa
cccttcacgaatggcgaaatcttggcggccaagttccgcgagatgatcgacgaggcctac
gccaccttccgccatccggccattgcaccgctcgtccagaccggccccaactctttcgtc
atggaactcttccacggttcgacgctcgccttcaaggacgtcgccatgcaattgctggcc
cgcctcatggaccatgtgcttgccgagcgcggcgaacgggcgacgatcgtcggggcgacc
tccggagatacgggaggagccgcgatcgacgcttttgccggtcgggaacggaccgacatc
ttcatcctcttcccgcacggcaaggtctcgccggtacagcagaggcagatgacgaccgcg
ggcgcatcgaacgtgcatgcgatcgccatcaagggaaatttcgacgattgccagaatctc
gtcaaagcgatgttcaacgacacggcctttcgcgaccgcgtcaagctctcgggcgtcaac
tcgatcaactgggcgcgcatcatggcgcagatcgtctattacttcacgacggcaatcgcg
cttggcggccctgaccggaggatttccttcacggtgccgaccggcaatttcggcgacatc
ttcgccggctatgtcgccaaacgcatgggcctgccggtcgacaagctgatcatcgcgacc
aacgagaacgacattctggcgcgcacgctgaagaccggccgctacgagatgcgcgaggtc
aaggcgacgacctcgccctcgatggacattcagatctcatccaacttcgaacggctgctg
ttcgaggtctatgggcgcgaggctgaaggggtgcgcgccgcaatggcaagcctcaagcaa
tccggatcctttgcaatcgcagagggcgcactaaaaaaaattcgcaaggaatttcgcgcc
ggccgcgcctcggaaaagcaggtggccgcaacgatccgcgacacgttcgagaaatcgggc
tatctccttgatccgcatacggcaatcggcgtctgcgtcgccgccaggcacgagaagcca
tcggcaccgatggtaacgctcgggaccgcccaccccgcgaaatttcccgacgccgtaaaa
tcggcaagtggtattgaccccacgcttccgacgtggcttgctgatctcatgactggggcg
gagcgtttcgatatcctggatgctgagctgaaaaaggtcgaaaccttcatcggcgagcgt
acccgcgttcgggaatag

DBGET integrated database retrieval system