KEGG   Sinorhizobium fredii USDA 257: USDA257_c08700Help
Entry
USDA257_c08700    CDS       T02188                                 

Gene name
gmk
Definition
guanylate kinase Gmk (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sfd00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
910877..911536
Genome map
AA seq 219 aa AA seqDB search
MKSATASPIRIARRGLMLVISSPSGAGKSTIARNLLEADPELSISVSVTTRARRPSEIEG
RHYYFKTVREFEALRATDSLLEWAEVHGNFYGTPRDAVETAMAEGRDMLFDIDWQGAQQL
QEKMAGDVVSIFILPPSMAELQSRLHRRAEDTEEVIATRLANSRAEIEHWREYDYIVVND
DLDRAFSSVRSIIEAERLRRDRRPGLFEFVNGLLTENPF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcggcgactgcctcgcccatcaggatcgcccgtcgcggtttgatgcttgtgatc
tcgtcgccttcgggtgccggcaaatcgacgatcgcgcgcaatctcctcgaagccgatccg
gaactgagcatctcggtgagcgtgacgacgcgcgcccggcgcccgagcgagatcgagggg
cggcattactacttcaagaccgtccgcgaattcgaagccttgagggcgacggactcgctt
ctcgaatgggccgaggtgcacggtaatttttacggaacaccgcgcgacgccgtcgaaacc
gctatggccgaagggcgcgatatgctcttcgatatcgactggcaaggtgcgcagcaattg
caggaaaagatggcgggcgacgtcgtctcgatcttcatcctgccgccgtccatggccgag
ctgcagtcccgcctgcatcggcgcgccgaagacaccgaagaagtgatcgccacccggctt
gccaactcacgcgccgagatcgagcactggcgggaatacgactatattgtcgtcaacgac
gatctggaccgtgccttttcttcggtccgctcgatcatcgaagcggagcgcctgcgccgc
gaccggcgacccgggctgttcgaattcgtcaacggtcttctgacggagaatccgttctag

DBGET integrated database retrieval system