KEGG   Sinorhizobium fredii USDA 257: USDA257_c08780Help
Entry
USDA257_c08780    CDS       T02188                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sfd00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sfd00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:sfd03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:sfd03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sfd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
920993..921442
Genome map
AA seq 149 aa AA seqDB search
MTEILFYHLTESKLEDALPPLLDKSIERGWRVVVQTVDAERREALDTHLWVYRDDSFLPH
GTDAGEFATEQPILIVADNGNQNGATVRFLVDGAEPPPVSEYERVVFMFDGYDQQQLEAA
RGQWKRLKGEGHNLTYWQQNRDGRWEKKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaatccttttctaccacctgaccgaatcgaagctcgaggacgccctgccgccg
ctcctggacaagagcatcgagcgcggctggcgggtggtcgtgcaaacagttgacgcggaa
aggcgcgaagcgctcgacacgcatctctgggtctatcgcgacgacagcttcctgccgcac
ggtacggatgcgggcgaattcgcgaccgagcaaccgatcctgatcgtcgccgacaatggc
aaccagaacggggcgaccgtgcgctttctcgtcgatggcgccgagccgccgccggtctcc
gaatacgagcgcgtcgtcttcatgttcgacggctacgaccagcaacagctcgaggcggcg
cgcggccaatggaagcggctgaagggcgaggggcacaacctcacctattggcagcagaac
cgcgacggccgctgggagaagaaggcctga

DBGET integrated database retrieval system