KEGG   Sinorhizobium fredii USDA 257: USDA257_c10340Help
Entry
USDA257_c10340    CDS       T02188                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    USDA257_c10340
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    USDA257_c10340
Enzymes [BR:sfd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     USDA257_c10340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1080932..1082851
Genome map
AA seq 639 aa AA seqDB search
MQPVSYRLESAWQPDGGLNGRFTFSLFNLSGRPLSGFRLVYTSLTRVIEPAACENAVFLR
RNANFHEFAPPEGLTLQPGESWTFTVSGLHRQAKHCTDGAKSAYLTLSDGKHVPVTVSDL
RLEGATSEPPPLRLPEGRLDLPFALQPWPAEVDAVPGEGFPVLLYPSAASSAEDIAALSN
VLALFQRLFSGGHAPFSLVPSGQGLPIVFVKNGELGGEAYRLAFSGRDIRLEYGAAAGRQ
YGLTTLAQLLDGARNHPAKFRFPASGTISDQPRYGWRGCHLDVSRQFYPAADVLRLIDIL
AWLKLNIFHWHLTDDEAWRLEIKAFPTLTTLGVLRGPDEPMLPQLGNGAVPSGGFYSQKE
IKAIVAHAAALNVEVVPEIDIPGHSTAALVALPELADGQEAPESYHSVQGYPNNALNPAV
PLTYEFLEKVFDEMVELFPSRYIHIGGDEVANGSWLASPLARKLMEEEGISGTFALQSYF
LKKVKQMLTARGRKLVGWNEVAHGGGVGIEGTLLMAWENPKVGIELAREGYDVVMTPGQA
YYLDMAQADAWQEPGASWAGTATPAHTYAYEAEGEFPDELKSRMKGVQACIWSEHFLSRG
YFNRLVFPRLAAIAEAAWTPKSEKDWLRFAAIAPLAPTL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgcagccggtctcttatcgccttgaatctgcctggcaaccggatggtggcctcaacggg
cgcttcaccttcagcctcttcaacctttccggcagaccgctgagcggcttccgtctcgtc
tatacgtcactcacccgcgtcatcgaaccggccgcctgcgagaacgccgtcttcctgcgc
cgcaacgccaatttccatgagttcgcgccgcccgaggggctgacgctacagcccggcgaa
agctggaccttcaccgtcagcggcctgcaccggcaggcgaagcactgcaccgacggggcg
aagtcggcttatctgacgttgtccgacggcaagcatgtgccagtgacggtctccgatctt
cggctcgaaggcgcgacgagcgaaccgccgcccctgcgcctgcctgaaggccggctcgac
ctacctttcgcgttgcagccctggccggccgaggtcgacgcggtgcccggagaaggcttc
cccgtcctcctctatccgtcggcggcaagcagcgcagaggacatcgcggcgctctccaac
gtgctggcgctgtttcaacggctgttttccggcggccacgcccccttcagccttgtgccc
tccggtcaggggctgccgatcgtctttgtgaaaaacggcgaactcggcggcgaggcgtac
aggcttgccttctcgggtcgcgacatccggctcgaatacggcgccgccgccgggcggcaa
tacgggctgacgacgctggcacagcttctcgatggcgcccgcaatcatcccgccaaattc
cgcttcccggcttcaggcacgatttccgaccagccgcgttacggctggcgcggctgccat
ctggatgtgtcgcggcaattctatccggccgccgacgtcctgcgcctgatcgacattctt
gcctggctcaagctcaacatcttccattggcatctgacggatgacgaggcctggcggctg
gagatcaaggcttttcccacgctgacgacgctcggcgttctgcgcggacccgacgaaccg
atgctgccgcagctcggcaacggcgccgtaccttcgggaggcttctacagccagaaagag
atcaaggcgatcgtcgcgcatgcggccgccctcaatgtcgaggtggttcccgagatcgac
attcccggccacagcacagcagcgctcgttgccttgcccgagctcgccgatgggcaggag
gcgccggagagctatcattcggtccaaggctatcccaacaacgcgctcaatccggccgtc
ccgctcacctatgaattcctcgaaaaggtcttcgacgaaatggtcgagctctttccgagc
cggtacatccacatcggcggcgacgaggtggcgaacggctcctggctggcctcgccgctg
gcgcgaaagctgatggaagaggaaggcatttccggcaccttcgcgttgcaatcctacttc
ctgaaaaaagtgaagcagatgctgacggcgcgcggccgcaagctggtcggctggaatgag
gtcgcccacggcggcggtgtcggaatcgaggggactttgctgatggcctgggagaacccg
aaggtcgggatcgagctggcgcgcgagggttatgacgtggtgatgacccccggccaggct
tactacctcgacatggcccaggcggacgcctggcaggaacccggcgccagctgggccggc
acggcaacgccggcgcatacctatgcctatgaggcggagggcgagtttcctgacgaactg
aagagccgcatgaagggggtgcaggcctgcatctggtcggagcatttcctgtcgcgcggc
tatttcaaccggctcgtcttcccgcgcttggcggcgatcgccgaggcagcctggacgccg
aagtctgaaaaggactggctgcgctttgccgcgatcgctcctctcgccccgacgctgtga

DBGET integrated database retrieval system