KEGG   Sinorhizobium fredii USDA 257: USDA257_c11080Help
Entry
USDA257_c11080    CDS       T02188                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    USDA257_c11080 (algC)
   00030 Pentose phosphate pathway
    USDA257_c11080 (algC)
   00051 Fructose and mannose metabolism
    USDA257_c11080 (algC)
   00052 Galactose metabolism
    USDA257_c11080 (algC)
   00500 Starch and sucrose metabolism
    USDA257_c11080 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    USDA257_c11080 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    USDA257_c11080 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    USDA257_c11080 (algC)
Enzymes [BR:sfd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     USDA257_c11080 (algC)
    5.4.2.8  phosphomannomutase
     USDA257_c11080 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1167718..1169268
Genome map
AA seq 516 aa AA seqDB search
MAQMDLVSFKPGSPHEPLYESDRFALETSALIRPTGFREYDARWWFGRPDDRKPPELNLM
GVQALGMGLGTFIRRSGAGPEIVTGHDFRSYSLAIKLALVSGLMAAGARVKDIGLALSPM
AYFAQFALDVPSVAMVTASHNENGWTGVKMGTARPLTFGPDEMAELKRIVLEADFDLAGG
GAYEFVPDFRQRYIDDLTRGKLIARKLKVVVACGNGTAGAFAPQVLERIGCEVIPLDCEL
DHSFPRYNPNPEDLAMLHAIRDKVLESGADVGLGFDGDGDRCGVIDNEGGEIFADKVGVM
LARDLSALHPQSVFVVDVKSTGLFAADPVLKANGARADYWKTGHSYIKRRVAELGAIAGF
EKSGHFFFNPPLGRGYDDGLITAISVCEMLDRNPDRSMAELYRALPVTWSSPTMSPHCGD
EVKYDVVERVVERFRTMQRDGLPIAGQKIADLVTVNGVRVVIEDGTWGLVRASSNKPELV
VVVESPVSEAQQRAMFAAVDRVLREHAEVGPYNQTF
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatggatcttgtttcctttaaaccaggctcgccgcatgagccgctctacgaa
tccgatcggtttgcactcgaaacgagcgcgctgatcagaccgacagggtttcgggagtat
gacgcgcggtggtggttcggtcggccggacgacaggaagcctccagagctaaatttgatg
ggggtgcaggcgctgggaatggggctcggcaccttcatccgacgctcgggcgccggtccc
gagattgtgacggggcatgacttccgctcctactcgcttgccatcaagctcgccttggtc
agtgggctgatggccgccggcgcgcgggtcaaggacatcggcctggctctgtcgccgatg
gcctatttcgcgcaattcgcgctcgacgtgccgtcggtggcgatggtcaccgcttcgcac
aacgagaacggttggacgggcgtcaaaatgggcacggcccggccgctgactttcggaccc
gacgagatggccgagttgaaaaggatagtgctggaggccgacttcgacctcgccggcggc
ggcgcctatgagttcgtcccggacttccgccagcgctacatcgacgatctgacccgtggc
aagctgatcgcccggaagttgaaagtcgtggtggcatgcggaaatggcaccgccggcgcc
ttcgcgccccaggtgctggagcggatcggctgtgaggtgatcccgctcgactgcgagctc
gaccattccttcccgcgctataatcccaatcccgaggacctggcgatgctccatgccatc
cgggacaaggtgctggaaagcggcgccgatgtggggctgggcttcgacggcgacggcgat
cgctgcggggtgatcgataatgaaggcggcgagatcttcgccgacaaggtcggagtgatg
ctggcacgggatttatccgccttgcatccccaatcggtgttcgtggtcgatgtgaagtcg
acggggctgttcgcggccgatccggtgttgaaggcaaacggcgctcgcgccgactattgg
aagaccggccattcctacatcaagcgcagggtcgccgaactcggcgccatcgcgggtttc
gaaaaatcggggcacttcttcttcaacccgcctctcgggcgcggctatgacgacggactg
atcaccgcgatctccgtctgcgagatgctcgaccgcaatccggacaggagcatggccgag
ctctatcgggctcttcccgtgacctggagctcgccgacgatgtcgccgcattgcggcgac
gaggtgaaatacgacgtcgtcgagcgcgtggtggagcggttcaggaccatgcagcgcgac
ggcctgccgattgccggtcagaagatcgccgatctggtcaccgtgaacggcgtacgtgtg
gtgattgaggacggcacttggggtctggtgcgggcctcctccaacaagccggagcttgtc
gtcgtggtggaaagcccggtctcggaagcacagcagcgggccatgttcgcggcggtagac
cgcgttctcagggagcatgcggaggtaggcccctacaaccagacgttctga

DBGET integrated database retrieval system