KEGG   Sinorhizobium fredii USDA 257: USDA257_c11960Help
Entry
USDA257_c11960    CDS       T02188                                 

Definition
(GenBank) endoglucanase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
sfd  Sinorhizobium fredii USDA 257
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1260526..1261569
Genome map
AA seq 347 aa AA seqDB search
MRYLLIFALLMVVLVRPVEADERQASVKADAWVEYKSKFLDSSGRILDDANGNVSHSEGQ
GYGLLLSFLANEPADFEQIWSFTRRELLLRDDGLAAWKWSPDVDPHVTDVNNATDGDILI
AYGLALAAERWSRSDYSQAAVTIAKAILDKTVIDHGGRTLLLPGVAGFSASDRDDGPVIN
PSYWVFEALPVLDRVVPSPKWRALGADGKAMIQAMKFGPQDMPADWVSAKTTLKPAAGFP
REFGFNALRIPLYVMRAEQADRELLLRLQRGMSGPDGELVTRDLETGAVRATLTDPGYRF
INHILACVLEGTKVPEDAKAFHPTQYYPSTLHLLGLSFVEEKHPECL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagatacctgttgatattcgcgctccttatggtggtgttagtcagaccggtcgaagcg
gatgagaggcaggcaagtgtgaaggccgacgcctgggtggagtacaagtcaaagttcctc
gattcgagcgggcgcatcctcgacgatgccaatggcaatgtcagccacagcgagggacag
ggatacggcctgctcctgtcgttcctggcaaacgaacctgccgatttcgagcagatctgg
tccttcacccgtcgcgagcttctgttgcgcgacgacgggctggccgcctggaaatggagc
ccggatgttgatccccatgtgaccgacgtcaacaacgcgacggacggcgacatcctgatt
gcatatggtttggcgctcgctgctgagcgctggagccgaagtgactattcgcaggcggca
gtcacgatcgccaaggctattctcgacaagaccgtcatcgatcacggcgggcgcacactg
ctgctgcccggcgtcgcggggttttccgcctctgatcgcgacgatggccccgtcatcaat
ccctcctactgggtcttcgaagcactgcccgtgctcgaccgcgtggttccttcgccgaaa
tggcgggcgctcggagcggacggcaaggcaatgatccaggccatgaaattcggtccgcag
gacatgccggccgattgggtgagcgccaaaacgacactcaaaccggccgccggatttccg
cgcgaattcggtttcaatgccctgcgcataccgctttacgttatgcgcgcggaacaagcg
gaccgtgagttgctgctgaggctgcaacgtggaatgtcaggcccggatggcgagcttgtg
acccgcgatctcgaaaccggggcggtgcgcgcgacgctgacggatcccggttatcggttt
attaaccatattctggcctgtgtgcttgaaggcaccaaggtgccagaggacgccaaggcg
ttccacccgacgcaatattacccttcgaccctgcacctgctgggactgtctttcgtggag
gaaaagcatccggagtgtttatga

DBGET integrated database retrieval system