KEGG   Sinorhizobium fredii USDA 257: USDA257_c11960Help
Entry
USDA257_c11960    CDS       T02188                                 

Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    USDA257_c11960
Enzymes [BR:sfd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     USDA257_c11960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1260526..1261569
Genome map
AA seq 347 aa AA seqDB search
MRYLLIFALLMVVLVRPVEADERQASVKADAWVEYKSKFLDSSGRILDDANGNVSHSEGQ
GYGLLLSFLANEPADFEQIWSFTRRELLLRDDGLAAWKWSPDVDPHVTDVNNATDGDILI
AYGLALAAERWSRSDYSQAAVTIAKAILDKTVIDHGGRTLLLPGVAGFSASDRDDGPVIN
PSYWVFEALPVLDRVVPSPKWRALGADGKAMIQAMKFGPQDMPADWVSAKTTLKPAAGFP
REFGFNALRIPLYVMRAEQADRELLLRLQRGMSGPDGELVTRDLETGAVRATLTDPGYRF
INHILACVLEGTKVPEDAKAFHPTQYYPSTLHLLGLSFVEEKHPECL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagatacctgttgatattcgcgctccttatggtggtgttagtcagaccggtcgaagcg
gatgagaggcaggcaagtgtgaaggccgacgcctgggtggagtacaagtcaaagttcctc
gattcgagcgggcgcatcctcgacgatgccaatggcaatgtcagccacagcgagggacag
ggatacggcctgctcctgtcgttcctggcaaacgaacctgccgatttcgagcagatctgg
tccttcacccgtcgcgagcttctgttgcgcgacgacgggctggccgcctggaaatggagc
ccggatgttgatccccatgtgaccgacgtcaacaacgcgacggacggcgacatcctgatt
gcatatggtttggcgctcgctgctgagcgctggagccgaagtgactattcgcaggcggca
gtcacgatcgccaaggctattctcgacaagaccgtcatcgatcacggcgggcgcacactg
ctgctgcccggcgtcgcggggttttccgcctctgatcgcgacgatggccccgtcatcaat
ccctcctactgggtcttcgaagcactgcccgtgctcgaccgcgtggttccttcgccgaaa
tggcgggcgctcggagcggacggcaaggcaatgatccaggccatgaaattcggtccgcag
gacatgccggccgattgggtgagcgccaaaacgacactcaaaccggccgccggatttccg
cgcgaattcggtttcaatgccctgcgcataccgctttacgttatgcgcgcggaacaagcg
gaccgtgagttgctgctgaggctgcaacgtggaatgtcaggcccggatggcgagcttgtg
acccgcgatctcgaaaccggggcggtgcgcgcgacgctgacggatcccggttatcggttt
attaaccatattctggcctgtgtgcttgaaggcaccaaggtgccagaggacgccaaggcg
ttccacccgacgcaatattacccttcgaccctgcacctgctgggactgtctttcgtggag
gaaaagcatccggagtgtttatga

DBGET integrated database retrieval system