KEGG   Sinorhizobium fredii USDA 257: USDA257_c12890Help
Entry
USDA257_c12890    CDS       T02188                                 

Gene name
tpiA1
Definition
(GenBank) triosephosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
sfd  Sinorhizobium fredii USDA 257
Brite
Enzymes [BR:sfd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     USDA257_c12890 (tpiA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1361348..1362115)
Genome map
AA seq 255 aa AA seqDB search
MSKSRLWVGTSWKMNKTLAEALTFADGLAAADAERDLRIQRFVIPPFTTVREVKQRLKAT
SVKVGAQNMHWEDAGAWTGEISPLMLKDCGLDLVELGHSERREHFGETDRTVGLKTAAAV
RHGLVPLICIGETLTEREAGEADAVLKRQVEGAFAFLDGDAKRASILLAYEPVWAIGVNG
IPATADYADARHRRIAEVAEAALGVAVPVLYGGSVNPGNCEELMAQPYIDGLFIGRSAWE
VGGYLDILKRVAGAI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatcgcggctctgggtcggcaccagttggaagatgaacaagacgcttgcggag
gcgctgaccttcgccgatggcctggcggcggccgacgcggagcgcgacctgcgcatccag
cgtttcgttattccgccctttaccacggtccgcgaggtcaagcagcgactgaaggcgacg
agcgtcaaggtcggcgcgcagaacatgcattgggaggatgccggcgcctggaccggcgag
atttctcctttaatgctgaaggattgcggcctcgatctcgtcgaactcggtcacagcgag
cgccgcgaacacttcggcgagaccgatcgcaccgtcggtctcaagacggcggcggccgtc
aggcacggtctcgttccgctgatctgcatcggcgagacgctcactgagcgggaggcgggc
gaggcggatgcggtcttgaagcgtcaggtggaaggagcgttcgccttccttgatggtgac
gcgaagcgggcgtcgatcctgctggcctacgagcccgtctgggcgatcggcgtcaacggc
atcccggcgaccgccgattatgccgacgcccgccacaggcggattgccgaggtggccgag
gccgcgctcggcgtcgctgtgccggtgctctacggcggcagcgtcaatcccggcaactgc
gaggaactgatggcccagccctatatcgacggcctcttcatcggccgctccgcctgggag
gtcggtggctatctcgacattctgaagcgtgtcgccggcgcgatctga

DBGET integrated database retrieval system