KEGG   Sinorhizobium fredii USDA 257: USDA257_c13900Help
Entry
USDA257_c13900    CDS       T02188                                 

Gene name
exoN1
Definition
UTP--glucose-1-phosphate uridylyltransferase ExoN (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    USDA257_c13900 (exoN1)
   00052 Galactose metabolism
    USDA257_c13900 (exoN1)
   00500 Starch and sucrose metabolism
    USDA257_c13900 (exoN1)
   00520 Amino sugar and nucleotide sugar metabolism
    USDA257_c13900 (exoN1)
Enzymes [BR:sfd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     USDA257_c13900 (exoN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1471448..1472353
Genome map
AA seq 301 aa AA seqDB search
MDRIRTVRKAVIPVAGNGTRFLPATKAVPKEMLTIVDRPVVQYAVDEARQAGIEHIVFVT
SRNKQVIEDHFDDSPELISSLSRSGKNAQISELEAMLPAAGSVSFTRQQAPLGLGHAVWC
ARDLIGDEPFALLLPDMVSFGARGCMAGLMDLYREVGGNVVAVEQCAPEEASKYGIVGKG
ETVRHGFSVSEMVEKPPAGQAPSNYYLNGRYILQPEIFSILAHQTRGAGNEIQLTDGMLT
LSASQSFHAHPYEGRTFDCGSKQGFIEANVAFALARADIGDIVFESVREIVLSHESRIRA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcatcaggaccgtcaggaaagcagtgatcccggtcgcaggaaacggaacgagg
ttccttcccgcgacaaaggccgtgccgaaggaaatgttgacgatcgtcgatcgccccgtc
gtccaatacgcggtcgacgaggcgcgtcaggccggcatcgagcacatcgtcttcgtcacc
agccgcaacaagcaggtgatcgaggaccatttcgacgactcgcccgaacttatctcgtcg
ctgtcgcgctcgggcaagaacgcgcaaatctccgagctcgaagccatgttgccggcggcc
ggctcggtcagcttcacgcgccagcaggcgccgctcggccttggccacgccgtctggtgc
gcgcgcgacctgatcggcgacgagcccttcgcattgctgctgccggatatggtgtccttc
ggggcgcgcggctgcatggccggactcatggacctctatcgcgaggtcggcggcaacgtc
gtcgcggtcgagcagtgtgcacccgaagaggcgtcgaaatatggtatcgtcggcaaggga
gaaaccgtgcgccacggtttctcggtgtccgagatggtggaaaagccgccggcgggccag
gcgccgtccaactattatctcaacggccgctatatcctgcagccggagatcttctccatt
ctcgcgcaccagacgcgcggtgccggcaacgaaatccagctgaccgacggcatgctgacg
ctttcggcgtcccagtccttccacgcccatccctatgaaggccgcaccttcgactgcggc
tcgaagcagggcttcatcgaggccaatgtcgccttcgcgctcgcccgcgccgatatcggc
gacatcgtgttcgaatccgttcgtgagatcgtcctgtctcacgaaagccgcatccgggcg
gcataa

DBGET integrated database retrieval system