KEGG   Sinorhizobium fredii USDA 257: USDA257_c14670Help
Entry
USDA257_c14670    CDS       T02188                                 

Gene name
asnB1
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    USDA257_c14670 (asnB1)
Enzymes [BR:sfd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     USDA257_c14670 (asnB1)
Peptidases [BR:sfd01002]
 Cysteine Peptidases
  Family C44
   USDA257_c14670 (asnB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1553404..1555401)
Genome map
AA seq 665 aa AA seqDB search
MLRAFHLYIQRGCGRESDFHMCGFSGYFGSIRDGRALLESMTAAIAHRGPDEQGIFIAPE
AGLGHVRLSIVGLGDGQQPMSDASGELTIAFNGEIFNYVELRDELRAKGRRFRTSSDTEV
ILHLYDEMGEECVSLLNGDFAFAIWDARRRRMMLARDRMGVRPLFYTAYGGTFYFASEVK
ALLQVPGVSAEIDPIALDQIFTLWAPIAPRTPFRNILELEPAHLMTVDQHGVTTRPYWQL
QYPDRDQPPVYVDEGSAAEELRALLTDATRIRMRADVPVGAYLSGGLDSSIVSALAAGMT
PQRLRTFSVTFDSAEHDESAFQLEMAAALGTQHSAIACRTGDIAKSFPDVIRFTERPIIR
TAPAPLYQLSGLVREAGLKVVLTGEGADEVFAGYDIFKEARVRRFCGRQPGSHIRPHLFR
KLYPYLPGLKQQSPEYLAAFFGAGDAPLDDLLFSHRPRLKGTAATKLFFSGDLRAQLKDY
DAADELIGRLPQDFGRWHPLHQAQYLESRFLLPGYILSSQGDRMAMAHGIEGRFPFLDHR
LVEFAAKLPPEMKLKGLTEKHILREATKDLLPAVIGKRVKQPYRAPDSHSFSGPGELDYV
RGALSEDAVAEGGLFNVRAVTKLYEKCRARPASGFRDNAAFVGILSTQLWLQTFTGAGIG
KAEAA
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
ttgctccgcgcattccatctatacattcaacgcggttgcgggcgtgagagcgattttcat
atgtgtggtttcagcggctattttggttcgatacgggacggaagggcgcttctcgaaagc
atgacggccgcgattgcgcatcgggggccggatgagcagggcattttcattgcgcccgaa
gcagggctgggccatgtgcggctttccatagtcgggctcggcgacggccagcagccgatg
tctgatgcgagcggcgagctgacgatcgccttcaacggcgaaatcttcaactatgtggag
ctcagggacgagcttcgcgccaagggccgccgcttccgcacctcgagcgacaccgaggtc
atcctccacctttatgacgagatgggcgaggagtgcgtgtcgttgctcaacggcgatttc
gccttcgccatctgggatgcccgtcgccgccggatgatgttggcgcgggaccgcatgggt
gtgcgcccgcttttctataccgcgtatggcggcacgttctacttcgcttccgaggtcaag
gcgctccttcaggtgcctggcgtttcggcggagatcgacccgatcgcgctcgaccagatc
ttcaccctctgggcgccgatcgcgccccgcacgccgttccgcaacatcctcgagcttgaa
ccggcgcacctgatgaccgtcgatcagcatggcgtcacgacgagaccttactggcaactg
caatatccggaccgggatcagccgccggtctacgtggacgaaggaagtgccgcagaggag
ttgcgcgccctcttgaccgacgcgacccgtatccgcatgcgggccgacgtaccagtcggc
gcctatctgtccggcgggctcgattcctcgatcgtctcggcgctggccgccggcatgacg
ccgcagcggcttcggaccttctcggttaccttcgacagcgccgaacacgacgaaagtgcc
ttccagctggaaatggctgcggcgctcggcacgcagcatagcgcgatcgcttgccgcacc
ggcgatatcgcaaagtcctttccggacgtcatccgcttcaccgagaggccgatcatccgc
acggcgccggccccgctctatcaattgtccgggctggttcgggaggcggggctcaaggtc
gtgctgactggcgagggcgccgacgaggtgttcgccggctacgacatcttcaaggaagcc
cgggtgcgccgcttctgcggacggcagccgggctcgcacatccggccgcatctcttccgc
aagctctatccctatctgccgggtctcaagcagcaatcgccggaatatctcgccgccttt
ttcggcgccggcgacgcgccgctcgacgacctcctcttctcgcatcgcccgcgcctcaag
ggcacggccgcgacgaaactgtttttctccggcgacctgcgtgcgcaactgaaggactac
gatgcggctgacgaactgatcggccggctgccacaggatttcggtcgatggcacccactg
caccaggcgcaatatctcgaaagccgcttcctgttgcccggctacatcctctccagccaa
ggcgaccggatggcgatggcccacgggatcgagggccgcttccccttcctcgaccatcgg
ctggtcgagtttgcggcgaagctgccgccggaaatgaagctcaagggcctcacggagaag
catatcctgcgcgaagcgacgaaggacctcttgccggctgtgatcggcaaacgggtgaag
cagccctatcgcgcacccgacagccattcgttcagcggccccggcgagctcgattacgtc
cgcggcgccttgagcgaggatgcggtcgccgagggcggcctcttcaatgtcagggcggtg
acgaagctctacgagaaatgccgcgcgcgcccggcctcgggcttccgcgacaacgccgcc
ttcgtcggcattctctcgacgcagctgtggctgcagacattcaccggcgccggcatcggc
aaggccgaagcggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system