KEGG   Sinorhizobium fredii USDA 257: USDA257_c14850Help
Entry
USDA257_c14850    CDS       T02188                                 

Gene name
glpK1
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    USDA257_c14850 (glpK1)
Enzymes [BR:sfd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     USDA257_c14850 (glpK1)
Exosome [BR:sfd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   USDA257_c14850 (glpK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1570904..1572373
Genome map
AA seq 489 aa AA seqDB search
MTTAILAIDQGTTNSKAVLVSTSGEILSRGSSSVGIEHPQPGWVEQSPLRIWESVQEAIA
ACLQAGPAVDVLGIAISNQRESVTVWDAATGKPLGPVVSWQCRRSAPVCAELIAAGHAAR
VQALTGLPIDPMFPGPKMKWLLDRVPAGHDVRLGTIDAWLIHCFTDGAVHACDAANAARS
QLYDLNRQAWSDELCDLFGVPKSTLPEVRDSASRFGVTRNVPGLPDGIPIASAIGDSHAA
LFGHGAFNPGDGKVTFGTGSSIMTTLPRFVAPHQGITTTIAWSIGGQPTYAFEGNILVSA
AALPWMVEMLGLPDVQALTDLAATAEPGGPGFVPAFVGLGAPYWQADARALFSGITFNTT
RAQMARAVTDSMAFQVHDVFKVISAQSPTPLGHLYADGGPSKNTFLMQCVADTLNQVITQ
CDAPEASALGAAYLAGLSLDVWPDLAAIAALPRAGNALVPRACDATERLLVWQDAIYRST
LSAPSTMSE
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgccattctcgccatcgaccagggcacaacgaattcaaaggccgtgctcgtt
tcgacgagcggagaaatcctgtcgcgcggttcgtcttcggtcggcatcgagcacccgcag
cccggctgggtggagcagagcccgctgcgcatatgggaatcggtgcaggaggcgattgcc
gcctgtctgcaggccgggcccgccgtcgacgtcctgggcatcgcgatttccaaccagcgc
gagtcggtcaccgtttgggatgccgcaacgggcaagccgctcggcccggtggtgagctgg
caatgccgccgcagcgcgccggtctgcgccgaactgatcgcggcgggccacgccgcccgc
gtccaggcgctcaccggcctccccatcgacccgatgttccccggccccaagatgaaatgg
ctgctcgatcgcgtccccgccggacacgacgtccggttgggtacgatcgacgcctggctg
atccattgcttcacggatggcgcggtgcatgcctgcgacgccgccaatgccgcccgcagc
cagctttacgatctcaaccgccaggcgtggagcgacgagctctgcgacctgttcggcgtg
ccgaaatccaccctgccggaggtgcgggacagtgcgtcccgcttcggcgtgaccagaaat
gtgcccgggctcccggacggtattccgatcgcctcggctatcggcgacagccatgcagcg
ctcttcgggcacggtgccttcaatcccggcgacggcaaggtgaccttcggaaccggctcg
tcgatcatgacgacgctgccccgcttcgtcgcgccgcaccagggcatcactacgacaatc
gcctggtcgatcggcggccagccgacctatgccttcgaaggcaatatcctcgtctcggcc
gcagctctgccatggatggtcgagatgctcggcctgccggatgtgcaagccctgaccgat
cttgccgcaacggctgagcccggcggccccggcttcgtgccggccttcgtgggcctcggc
gcaccctattggcaggcggatgcacgggcgctgttctccggcatcaccttcaacacgacc
cgcgcccagatggcccgcgctgtgacggattcgatggcctttcaggtccatgatgtcttc
aaggtcatctcggcgcagtcgccgacgccgctcggtcacctctatgcggatggcgggccg
agcaagaacaccttcctgatgcagtgcgtggccgatactctgaaccaggtcattacccag
tgcgacgcgcccgaggcctccgccctcggcgcggcctatctggcgggtctttcattggac
gtctggcccgatcttgccgccattgccgcgctgccgcgcgccggcaatgcccttgttccg
cgtgcttgcgacgccacggaaaggcttctggtctggcaggacgcaatctaccgctcgacc
ctttcggcgccttcaactatgagtgaataa

DBGET integrated database retrieval system