KEGG   Sinorhizobium fredii USDA 257: USDA257_c15550Help
Entry
USDA257_c15550    CDS       T02188                                 

Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00071  Fatty acid degradation
sfd00280  Valine, leucine and isoleucine degradation
sfd00281  Geraniol degradation
sfd00310  Lysine degradation
sfd00360  Phenylalanine metabolism
sfd00362  Benzoate degradation
sfd00380  Tryptophan metabolism
sfd00410  beta-Alanine metabolism
sfd00627  Aminobenzoate degradation
sfd00640  Propanoate metabolism
sfd00650  Butanoate metabolism
sfd00903  Limonene and pinene degradation
sfd00930  Caprolactam degradation
sfd01100  Metabolic pathways
sfd01110  Biosynthesis of secondary metabolites
sfd01120  Microbial metabolism in diverse environments
sfd01130  Biosynthesis of antibiotics
sfd01212  Fatty acid metabolism
Module
sfd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    USDA257_c15550
   00650 Butanoate metabolism
    USDA257_c15550
  Lipid metabolism
   00071 Fatty acid degradation
    USDA257_c15550
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    USDA257_c15550
   00310 Lysine degradation
    USDA257_c15550
   00360 Phenylalanine metabolism
    USDA257_c15550
   00380 Tryptophan metabolism
    USDA257_c15550
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    USDA257_c15550
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    USDA257_c15550
   00281 Geraniol degradation
    USDA257_c15550
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    USDA257_c15550
   00627 Aminobenzoate degradation
    USDA257_c15550
   00930 Caprolactam degradation
    USDA257_c15550
Enzymes [BR:sfd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     USDA257_c15550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AFL50145
UniProt: I3X2N9
Position
complement(1648465..1649532)
Genome map
AA seq 355 aa AA seqDB search
MEMQTALPDVIVERQGAIGRLRLNRPRALNSLNQAMIRAIDAALTEFERDQSIAAVLVTG
EGERGLCAGGDIRMIYESGRERPEEGAQFWREEFIVNSRIAAYRKPYIAIMDGIVMGGGV
GISSHGSHRIVTERTRFAMPETGIGYFTDVGATWLLPRGPGEFGTYLGLTGRDVGAAAAI
YARLADSFVLSENVNALIASLVDLPPSATAEDVSAAIRAVSGKAPASALLDHVALIDRCF
AYETVEEIFAALEEDGSDFARETVELLKTRSAISLKLTLSLLRAGRDSATLNACLEREYA
GCVAMLSNPDFYEGVRAAVIDKDRNPKWSIGLHEVTPQMLARFERYNGAPLFAGG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggagatgcagaccgctctaccggacgtcatcgtcgaacgccaaggcgcgatcggcagg
ctccggctcaaccggccgcgcgcgctgaacagcctcaaccaggcgatgatccgggcgatc
gacgcggcgctcaccgaattcgagcgcgaccagtcaattgccgccgtcctcgtgacgggc
gagggcgagcgtggcctttgcgccggcggcgatatccgcatgatctacgaaagcggccgc
gaacggcccgaggaaggggcgcaattctggcgcgaggagttcatcgtcaacagccgcatt
gctgcttatcgcaagccctatatcgccatcatggacggcatcgtcatgggcggcggcgtc
ggcatttcctcccacggcagccaccgcatcgtcaccgagagaacgcggttcgccatgccg
gaaacggggatcggctatttcaccgacgtgggggcgacctggctcctgccgcgcgggccg
ggcgagttcggcacctacctcggtctcaccggccgcgatgtcggtgctgcggcggctatc
tacgcgcggctcgccgacagcttcgtcctgtccgagaacgtcaacgcgctcatagcgtcg
cttgtcgatctgccgccgtcggcgaccgcggaggatgtttccgcggcgatccgcgccgta
tctgggaaggcgccggcctcggctctgcttgatcatgttgcgctcatcgatcgctgcttc
gcctacgagacggtcgaggaaatcttcgcggctctcgaagaagacggctcggacttcgcg
cgtgagacggtcgaactcctcaagacccgctcggccatcagcctgaagctcaccctgtcg
ctgctgagagccggacgcgacagcgcgacgctgaacgcgtgcctcgagcgcgaatatgcg
ggctgcgtcgccatgctgtcgaacccggacttttacgagggcgtgcgcgccgcggtgatc
gacaaggatcgcaatccgaaatggtcgatcgggcttcatgaggtcacgccgcaaatgctc
gcgcgcttcgaacgctataacggcgcgccgctttttgccggcggctga

DBGET integrated database retrieval system