KEGG   Sinorhizobium fredii USDA 257: USDA257_c16610Help
Entry
USDA257_c16610    CDS       T02188                                 

Gene name
pcm1
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sfd  Sinorhizobium fredii USDA 257
Brite
Enzymes [BR:sfd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     USDA257_c16610 (pcm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1761626..1762297
Genome map
AA seq 223 aa AA seqDB search
MKPMNEEHLAVLRRHMVEVIAIYADLASEELGKAALDERVMAAMLRVPRHLFVPASAAPL
AYQDMPLPIGFDKTVSQPFMVALMTDLLAPQPHEAVLEIGTGLGYQTAILAQLAGQIWSV
EIIEEFASHAEALLQRLGVSNVGIRVGDGSRGWPERAPFDKILVTAAAEEAPPALLGQLK
PMGRLVLPLGSEEQFLTVIDKNSAGQLEARQLIPVRFSRLEAV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatgaacgaagagcaccttgcggttctgcgcaggcacatggtcgaggtgatc
gcaatctatgctgaccttgcaagcgaagaactcggcaaggcggcgctcgatgaacgggtg
atggcagcgatgctgcgggtgccccgacatctcttcgtgcccgcttcggcagcgcccctt
gcctatcaggacatgccactgccgatcggcttcgataaaaccgtgtcgcagccattcatg
gtcgccctgatgaccgatctccttgctccccaaccgcatgaggcagtgctcgagatcggc
accggcctgggctaccaaaccgcaatcctggcgcaactcgccgggcagatctggagcgtc
gaaatcatcgaggaattcgcaagccacgccgaggctctcctacagcgcctcggcgtgtca
aatgtcggcatccgtgtcggagacgggtctcgcggctggcccgagcgcgccccattcgac
aagatcctcgtcacggcggcggccgaggaggcgccgccggctttgcttgggcagctcaaa
ccaatgggccgtctggttcttcctttgggctctgaagaacagtttctgactgtcatcgac
aagaattcggcaggacaactcgaggcgcgacaactcatcccggttcggttcagccggctc
gaggcggtctaa

DBGET integrated database retrieval system