KEGG   Sinorhizobium fredii USDA 257: USDA257_c18590Help
Entry
USDA257_c18590    CDS       T02188                                 

Gene name
tpiA2
Definition
triosephosphate isomerase TpiA (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    USDA257_c18590 (tpiA2)
   01230 Biosynthesis of amino acids
    USDA257_c18590 (tpiA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    USDA257_c18590 (tpiA2)
   00051 Fructose and mannose metabolism
    USDA257_c18590 (tpiA2)
   00562 Inositol phosphate metabolism
    USDA257_c18590 (tpiA2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    USDA257_c18590 (tpiA2)
Enzymes [BR:sfd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     USDA257_c18590 (tpiA2)
Exosome [BR:sfd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   USDA257_c18590 (tpiA2)
  Exosomal proteins of bladder cancer cells
   USDA257_c18590 (tpiA2)
  Exosomal proteins of melanoma cells
   USDA257_c18590 (tpiA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1967594..1968304)
Genome map
AA seq 236 aa AA seqDB search
MNGLSSSLEEVMAMTTTADRLDCDLVVIPPFTLIERACAASKGSKLLIGAQDCHAQKSGA
FTGDVSADMLLDAGAKFVILGHSERRTEHGETDALVSAKAATAIQSGLVAIICVGETQGE
RDANQTLAVIERQLAGSAPETATSANTVVAYEPVWAIGTGRVPTVAQIAEVHLAIHAALK
KRFGDDGGSVSVLYGGSVKPSNAESIFAIEYVDGALVGGASLKASDFSAIAEALNA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcctctcttcctccctagaagaggtcatggcgatgacgaccacggcggaccga
ctcgattgcgacctggtcgtcatccccccattcacgctcatagagcgagcatgcgccgca
tccaaaggatcgaagctcctgattggcgcgcaagattgccacgcacaaaaatccggagct
tttaccggagacgtctcagcagatatgcttctggatgctggtgcgaaattcgtgatcctg
gggcactcggaacgcaggaccgaacacggagagaccgacgcactggtatccgcaaaagcc
gcgacggcaatccagagcggcttggtggcgatcatttgcgttggcgaaactcaaggcgaa
agggatgcgaaccaaacgcttgccgtcatcgagcggcagctggccggttccgctccagag
acggcaacatcggccaacactgtcgttgcctatgagcccgtgtgggcgattggtacggga
cgcgtgcctactgtagcccagattgctgaagtccatcttgcgatccatgccgcccttaag
aagcggtttggggacgatggtggttccgtttcggtgctgtacggcggctcggtaaagcca
tcaaatgccgagtcaatctttgcgattgagtacgttgatggcgcactcgtcggcggggct
tcgctcaaagcctctgatttctccgcaattgcggaagcgctgaacgcttaa

DBGET integrated database retrieval system