KEGG   Sinorhizobium fredii USDA 257: USDA257_c18750Help
Entry
USDA257_c18750    CDS       T02188                                 

Definition
xylose isomerase domain-containing protein TIM barrel
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sfd00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sfd00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1984106..1985125)
Genome map
AA seq 339 aa AA seqDB search
MHNFTNWTNALNPTRFATRLNSFASGAHIAWPGQSGKPSVMQMAERAASVEGLTDLDLNY
PDHVSEDPAELSRKLGDLGLSINGFAMRYYTNPAFKLGAFTHPAEDVRRDAIDLTKKGID
AAREAGSNLMTIWLGQDGFDYAFQADYAKMWQHEIDGIREVCEHDTDCLISIEYKPNEPR
SYSLMPDAATTLLAIKEVGARNLGVTLDFAHVLYADEQPAFAAALIARHSRVLGVHLNDG
YAKRDDGLMVGAVHTLQTVELLRQIRRDGYEGAIYFDTFPDLTGLDPVHECEVNIRTVQR
MLKVVDRLEQDNRLASAIDRQDSVSTQAIVQELMFGADY
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgcataacttcacaaattggacgaatgccttgaacccgacacgtttcgcaacacgcctc
aactcgttcgcatccggcgcgcacattgcgtggccggggcagtccggaaagccttccgtc
atgcagatggcagaacgggccgcaagcgtggagggtctgactgacctcgacctaaactat
cccgaccatgtgagcgaagacccggcggaactctcgcggaagctgggcgatcttggtctt
tcgatcaatggcttcgccatgcggtactatacgaaccctgcgttcaagttgggtgcgttc
acccatccagctgaagacgtccgccgcgacgcgatcgatctcaccaagaaagggatcgat
gccgcgcgtgaagcgggttcgaacctgatgacgatctggctcggccaggacggcttcgat
tacgcgtttcaggcagactatgccaagatgtggcaacacgaaattgacggaatccgtgaa
gtctgtgagcacgatacggattgcctgatctccatcgagtacaagccgaacgagccgcgc
tcctacagtctcatgccggatgccgcgacgacgcttctggccatcaaggaagtcggtgcg
aggaacctcggagtcacgctcgacttcgcccatgtcctctatgccgacgagcagcctgcc
ttcgccgcggcacttatcgcccgtcacagccgggttctcggggtccatctcaacgacggc
tacgccaagcgcgacgacggtcttatggtcggcgcggtgcatacgctccagacggtcgaa
ctgcttcgccagatacgccgcgacggctatgagggggcgatctacttcgacacttttccc
gatctgaccggtctcgatccggtccatgaatgcgaggtcaacatcaggactgtccaaagg
atgttgaaggtcgtcgaccgcctcgagcaggacaatcgcctggcaagcgcgattgaccga
caggactccgtttccacgcaggccattgtgcaggaactgatgttcggcgcggattactga

DBGET integrated database retrieval system