KEGG   Sinorhizobium fredii USDA 257: USDA257_c18880Help
Entry
USDA257_c18880    CDS       T02188                                 

Gene name
pdhC1
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00010  Glycolysis / Gluconeogenesis
sfd00020  Citrate cycle (TCA cycle)
sfd00620  Pyruvate metabolism
sfd01100  Metabolic pathways
sfd01110  Biosynthesis of secondary metabolites
sfd01120  Microbial metabolism in diverse environments
sfd01130  Biosynthesis of antibiotics
sfd01200  Carbon metabolism
Module
sfd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    USDA257_c18880 (pdhC1)
   00020 Citrate cycle (TCA cycle)
    USDA257_c18880 (pdhC1)
   00620 Pyruvate metabolism
    USDA257_c18880 (pdhC1)
Enzymes [BR:sfd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     USDA257_c18880 (pdhC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFL50475
UniProt: I3X3L9
Position
complement(1998588..1999880)
Genome map
AA seq 430 aa AA seqDB search
MATEVILPKVDMDMATGRISKWFFGEGDAVKEGDVLFEIETDKAAMEIDAPASGVLRNVT
GKEGVDIAVGSAVAWIYAEGEAVNETAVPLSPSATAESPLPVSEAKTPAAEEAAERKAGS
AVRATPLARRLARERGLDLATLAGSGPHGRVVSADVLAISNSVADAWVQAEPTRTSGRSE
AGDNIVGENALRHFPDGSYELQAHTSMRRTIARRLVEAKSTVPHFYLSADCRLDALLKLR
AELNAAAPLGESVPAYKLSVNDLVIKAYALALAGVPDANVSWTDEHLVRHSHSDVGVAVS
VPGGLITPIIRQAEQKSLSTISNEMKDLAVRAKAGKLKPNEYQGGTGAVSNLGMYGVKEF
AAIINPPHSTILAVGAGEKRPVVTAEGELGVATVMSVTLSTDHRAVDGALGAELLAKFRA
LIENPLGMLV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcattttgccgaaggtcgacatggacatggccacgggcaggatctcg
aagtggttcttcggtgagggcgacgccgtgaaggagggcgacgtccttttcgagatcgag
accgacaaagcggctatggaaatcgacgcgccggcaagcggagtcctacgcaacgtgacc
ggcaaggaaggcgtggatatcgcagtcggctcggccgtcgcgtggatctatgccgaggga
gaggccgtcaacgagacggccgtccccctttcgccgtcggccaccgccgaaagtccgctg
cccgtatccgaggcgaagacgccggccgcagaggaagcagccgaacggaaagctggaagc
gcagtccgcgccacgccgctcgcacggcgcctcgcgcgggaacgcggactggatcttgcc
acactggccgggagcggccctcatggccgcgtcgtcagtgccgatgtgctggcgatttcc
aacagcgttgctgatgcctgggtacaggcggagcccacgcggacatcgggcagatcggag
gccggcgataacatcgtaggtgagaacgcgcttcggcattttcccgatgggtcctacgag
cttcaggcgcacacctccatgcgtcggacaatcgcccgacggctcgtggaggccaagagc
actgttccgcacttctacctttcggcggactgccggctcgatgcgctcctgaaattgcgc
gcggagcttaatgctgcggcgccgctgggcgagagcgtgccggcctacaagctctcggtg
aacgacctcgtcatcaaggcctatgcactagccctggcgggtgttccggacgctaacgtg
tcgtggacggatgagcatctggtgcgccacagccattcggatgtcggcgtggcggtttcc
gtccccggtggactgatcacccctatcatccgccaggcggagcaaaagagcctttcgacc
atctcgaacgaaatgaaggacttggccgtgcgtgccaaggcaggaaagctgaagcccaac
gaataccagggcggcacgggagcggtgtcaaacctcggaatgtacggcgtgaaggaattc
gctgcgatcatcaatcccccccactccacgatcctggcggtcggcgccggagagaagcgg
ccggtggtaaccgcagaaggggagttgggcgttgctacggttatgagcgtgacgctgtcc
acggaccatcgtgccgtggatggtgcgctgggcgcagagcttctcgcaaagttccgcgcg
ctcatcgagaatccattgggcatgctggtctag

DBGET integrated database retrieval system