KEGG   Sinorhizobium fredii USDA 257: USDA257_c22790Help
Entry
USDA257_c22790    CDS       T02188                                 

Gene name
melA2
Definition
alpha-galactosidase MelA (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sfd00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sfd00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sfd00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2384899..2386371
Genome map
AA seq 490 aa AA seqDB search
MGSFKIAIIGAGSVGFTKKLFTDILSVPELRDVEFALTDLSEHNLGMIKTILDRIVEANN
LPTRVTATTDRRKALEGARYIISCVRVGGLEAYADDIRIPLKYGVDQCVGDTICAGGILY
GQRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQ
IAEILGAKDGEFDYVCSGINHQTWFIDVRLNGRKIGKDELIAAFEAHPVFSKQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPDEITKWIDMSDWIHGETGGYLRYSTETRNWFETE
YPRFLEEAGRPLDTIKRSNEHASHILEALETGRVYRGHFNVKNNGVISNLPADAIIESPG
FVDRFGINMVSGITLPEACAATCISSINVQRMSVHAAITGDIDLLKLAVLHDPLVGAICT
PEEVWQMVDEMVVAQAQWLPQYAHAVEAAKDRLARSTVKTREWTGAARREVRSIEEIRAE
KEAAKLRAAG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcttcaaaatcgccattatcggcgccggcagcgtcggtttcaccaagaagctt
ttcaccgacatcctgtccgtgccggagctccgcgacgtcgagttcgccttgacggatctg
agcgagcacaatctcggcatgatcaagacgatcctcgaccggattgtcgaggcgaataat
cttccgacacgcgtcacggcaaccacagatcgacgcaaagcgctcgaaggcgctcgctat
atcatcagctgcgtccgggtgggcggcctcgaggcctatgcggacgatatccgcattccg
ctgaaatacggggtcgaccaatgcgtcggcgacacgatctgcgccggcggcattctctac
ggccagcgcaacattccggtcatcctcgatttctgcaaggacatccgcgaggtcgccgag
cccggggccaagttcctgaactatgccaacccgatggcgatgaacacctgggcggcgatt
gaatatggaaaggtcgacactgtcggtctctgccacggcgtccagcacggcgccgagcag
atcgccgagatcctcggcgccaaggacggcgagttcgactatgtctgctccggcatcaac
caccagacctggttcatcgacgtccgcctcaacggccgcaagatcggcaaggacgagctc
attgccgccttcgaggcccatccggtcttctccaagcaggagaagctcagaatcgacgtc
ctgaagcgcttcggcgtctattcgaccgaaagcaacggccatctctctgaatacctgccc
tggtaccgcaagcgccctgacgagatcaccaaatggatcgacatgtcggactggatccat
ggcgagaccggcggctacttgcgctattcgaccgagacccgcaactggttcgagaccgag
tatccgcgcttcctcgaagaggccggcaggccgctcgatacgatcaagcgctcgaacgag
catgcgagccatatcctcgaagcgctcgagaccgggcgcgtctatcgcggtcatttcaac
gtcaagaacaatggcgtgatcagcaacctgccggcggatgcgatcatcgaatctcctggc
ttcgtggatcgcttcggcattaacatggtgtccggcattacgcttcccgaggcctgtgcc
gccacctgcatctcgtcgatcaatgtccagcgcatgtccgttcatgcggcgatcaccggg
gacatcgaccttctgaagctcgcggtgctgcacgacccgctggtcggcgcgatctgcacg
ccggaggaggtctggcagatggtcgacgaaatggtcgtcgctcaagcacaatggctgccg
caatatgcccatgccgtcgaggcggccaaggatcggctcgcccgatcgacggtgaagacc
cgcgaatggacgggcgcggcccggcgcgaggtgcgctctatcgaggaaatccgcgccgag
aaggaagccgcaaagctgcgcgctgccggctag

DBGET integrated database retrieval system