KEGG   Sinorhizobium fredii USDA 257: USDA257_c22880Help
Entry
USDA257_c22880    CDS       T02188                                 

Gene name
mCD
Definition
MCD, malonyl-CoA decarboxylase MCD
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    USDA257_c22880 (mCD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    USDA257_c22880 (mCD)
Enzymes [BR:sfd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     USDA257_c22880 (mCD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2399027..2400448)
Genome map
AA seq 473 aa AA seqDB search
MPGTSFFSDMLQGITERGRKLLFAGSRTTDATVEADLATLCEMLLSSRGEASGMAIAAEI
LERWSKLDSAGVQQFLHMFSEKFGADTAKLDKAVDRYRAEKTPTAIIALHKAAEPRRQEL
LRRLNLAPNGTAKLVQMRQQLLGLKERPEEFRAVDTDFAHLFGSWFNRGFLTLRPIDWTT
PAHILEKIIKYEAVHEIAGWQELRRRLAPADRRCFAFFHPRLVDEPLVFVEVALTRSVPS
AIKDVLDEGREQINPDQATTAVFYSISNCQDGLRGISFGNFLIKQVVEDLRRDLPGLRTF
VTLSPVPGFARWLAKARSPEAEPLLTDEDRKVLVLLDDPAWVNDASTASEVERVLLPLAA
HYFLVERTPEGRPVDPVARFHLGNGARLDRLNFLGDRSAKAMQQAHGLMVNYLYKLEDIE
ANHEALAQRGEVTASPAVKILIGRNGDSRRGGKSELSRPFAQVMNGKIGGGRK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcccgggacctcttttttcagcgacatgctccagggtatcaccgagcgcggccgcaag
ctgttgtttgccggttcgcgcaccacggatgccacggtcgaagccgatctcgcgacgcta
tgcgaaatgctgctgtcgagccgcggcgaagcctccggcatggccattgccgccgagatc
ctcgagcgctggagcaaactcgacagtgccggcgtgcagcagttcctgcacatgttctct
gagaaattcggtgccgatacggcgaagctcgacaaggcggtcgacaggtaccgtgccgaa
aagacccccacggcgatcatcgcgcttcacaaggcggcggaaccgcgccgccaggagctt
ctgcgccggctgaacctggcgccgaacggcacggccaaactcgtccagatgcgtcagcaa
ctgcttggactgaaggagcggcccgaggaatttcgcgccgtcgacaccgacttcgcgcat
ctgttcggctcctggttcaatcggggcttcctgacgctgcgcccgatcgactggacgacg
ccggcgcacatcctcgaaaagatcatcaaatacgaggcggtgcacgagatcgccggctgg
caggaattgcgccgtcgcctggcgccggccgaccggcgctgctttgccttcttccacccg
cgactggtggacgagccgctcgtcttcgtcgaagtggcgctcacccgatccgtcccaagc
gccatcaaggacgtgctcgacgaaggcagggagcagatcaatcccgaccaggcgacgacc
gccgtgttctattcgatctccaactgccaggacggcctgcgcggcatctcgttcggcaat
ttcctgatcaagcaggtcgtcgaggacctgcgccgcgacctgcccggcctcaggactttc
gtcacgctttcaccggttccgggctttgcgcgttggctcgccaaggcgcgcagcccggaa
gccgagccgctgctgaccgacgaggaccgcaaggtcctggtgctgctcgatgatccggca
tgggttaatgacgcgagcacggcaagcgaggtcgagcgtgtgctgctaccgctcgcagcc
cattatttcctggtcgaacggacgccggaaggccgtcccgtcgatccggtcgcccgcttc
cacctcggcaacggggcccggctggacaggctgaatttcctcggcgaccgctccgccaag
gccatgcagcaggcgcacgggctgatggtcaactacctctacaagctcgaggacatcgag
gccaaccacgaggcgctggcgcaacgcggcgaagtgacggcatcgccggccgtcaagatc
ctcatcggccgaaacggggacagccgccgtggcggcaagagcgaactttcgcgaccgttc
gcacaggtcatgaacggcaagattggaggagggcgcaagtga

DBGET integrated database retrieval system