KEGG   Sinorhizobium fredii USDA 257: USDA257_c23430Help
Entry
USDA257_c23430    CDS       T02188                                 

Gene name
bdhA1
Definition
D-beta-hydroxybutyrate dehydrogenase BdhA (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sfd00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:sfd00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2460812..2461642
Genome map
AA seq 276 aa AA seqDB search
MLKSTDVETDAMLGRRTLEGRSAIVTGSTSGIGLGIAQALAKAGAAVMLNGFGDPAEIER
QRAEMAEENDVDVAYDSADMSRPEAIRMMVERAGARFGQVDIVVNNAGIQHVAPIAEFPE
AKWDAILSINLSAAFHLVQATYGQMRARGYGRIINVASAHGLVASPFKSAYVAAKHGLVG
LTKVVALEGAEFGVTANAICPGYVWTPLVEQQIDDQAKSHGVARDSVIRDVFLKNQPTKR
FATVEEMGALSVFLCSTAAASITGTAIPVDGGWTAH
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagagtaccgacgttgaaaccgatgcaatgctcgggcgcagaacgctcgaaggc
cgcagcgccattgtgaccggctccaccagcggcattggtctcggcatcgcccaggcgctg
gccaaggcgggcgcggcagtgatgctcaatgggttcggtgacccggccgagattgagcgg
cagcgggccgagatggcggaggagaacgacgtcgacgtcgcctatgacagcgccgacatg
tcgaggccggaggcgatccggatgatggtcgagcgcgccggcgcccgcttcggacaagtg
gatatcgtcgtcaataatgccggcatacagcatgtcgccccgatcgccgaattccccgag
gctaagtgggacgcgatcctctctatcaacctttccgccgcctttcatctcgtccaggcg
acctatgggcagatgcgggcccgcgggtacggccggattatcaacgtcgcatccgctcat
ggactcgtcgcatctccgtttaaatcagcttatgtggcggcgaagcatggtctcgtcgga
ctcaccaaggtcgtggccctggaaggtgccgagttcggcgttacggcgaatgcgatctgt
cccggctatgtgtggacgccgctcgtcgagcagcaaatcgacgaccaggcaaagtcccac
ggtgtcgctcgcgattccgtaatccgagacgtgttcctgaagaaccagccgacgaagcgt
ttcgcaacagtcgaagagatgggggcgctgagcgtcttcctgtgcagcaccgcggcggcc
tcgataaccggcacggcgatccctgtcgatgggggatggacggcccactga

DBGET integrated database retrieval system