KEGG   Sinorhizobium fredii USDA 257: USDA257_c30940Help
Entry
USDA257_c30940    CDS       T02188                                 

Gene name
cycA
Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sfd00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sfd02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3247801..3248214
Genome map
AA seq 137 aa AA seqDB search
MTSRLGALVAAVVVFGGIFTGAVEPALALDPAAGDPAAGEKVFRKCQACHAIGPDAKAKT
GPVLTGILGRPAGKAEGFAYSTAMGKVAESGLVWTPDKIGEFLTNPKAFLPGTKMTFAGL
RKDQERADLIAYLAKFP
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaagacttggtgccctcgtcgcggctgtagtcgtattcggcggaatattcacg
ggcgcggtcgaaccggcgcttgcgctggatcccgcggcgggtgatccggccgcgggcgag
aaggtctttcgcaagtgtcaggcctgtcacgcgattggtccggatgccaaggcaaagacc
ggccctgtgctgaccggcatactcggccggccagccggcaaagccgaaggctttgcctat
tccactgcgatgggcaaggtggctgagagcggcctggtctggacgccggacaagatcggc
gagtttctgaccaatcccaaagccttcctgcccggcaccaagatgacctttgcgggattg
cgcaaggatcaggagcgcgccgatctgatcgcatatctggcgaagtttccttaa

DBGET integrated database retrieval system