KEGG   Sinorhizobium fredii USDA 257: USDA257_c31430Help
Entry
USDA257_c31430    CDS       T02188                                 

Gene name
sucB1
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:sfd01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sfd00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:sfd00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3292955..3294184)
Genome map
AA seq 409 aa AA seqDB search
MGELVDINAPVEQEGTKAVVRNWLRKIGESVKSGDPLVELETDKVTQEVPAPADGVLKEI
LMENGDNATPGAVLGRIGSRAAGVDLPASPVPAVTLETSSAPPQSPHYSPAVRRAAEEYG
IDPATVAGTGRDGRVTRADMDRAFAAKPEHFEAAAEISAPEPQTPAPRSVSAEPGPALRS
RRIPHSGMRSAIATHMLQSMTTAPHVTAVFEADFSAIMRHRDAHKAKLAAESVALSYTAY
IVSACVAAMRAVPEVNSRWHDDALEVFDDINVGVGTALGDKGLIVPVIHQAQHLSLAGIA
AKLQDLTSRARSNALNAADVRGGTFTISNHGISGSLVAAPIIINQPQSAILGVGKLEKRV
VVREVDGVDTIQIRPMAYVSLTIDHRALDGHQTNTWLTHFVQTLESWPQ
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaacttgtcgacatcaacgcccccgtcgaacaggaggggacgaaggcggtcgtc
cgcaactggctcaggaagatcggcgaaagcgtcaaatcgggcgacccgctcgtcgaactc
gaaaccgacaaggtgacgcaggaggtccccgctcccgccgacggcgtcctcaaggaaatt
ttgatggagaacggcgacaatgccacccccggcgccgttctcggccggatcggcagccgg
gctgccggtgtcgatctgcctgcctcgcctgtgccggcggtcaccttggagacgtcgtct
gcccctccccagtctccgcattattcgccagccgtgcgccgcgctgcggaagaatacggc
atagatcccgcaaccgtagccggcaccggtcgggacggccgtgtcacgcgcgccgacatg
gacagggcctttgctgccaagccggagcatttcgaggctgcggccgaaatcagcgccccc
gagccgcaaactcccgctcccaggtcggtctccgccgagcccggaccggcgctgcgttcc
cgccggataccgcacagcggcatgcgctcagcgatcgccacccacatgctgcaatcgatg
acgacagcaccgcacgttaccgccgtctttgaagccgatttttcggcgatcatgcgccac
cgcgacgcccataaggcgaagctggcggcggagagtgtcgctctctcctacaccgcctat
atcgtttccgcctgcgtcgcggcgatgcgcgccgttcccgaggtcaacagccgctggcac
gacgatgcgctcgaagtgttcgacgacatcaatgtcggtgtcggaaccgcccttggcgac
aaaggcttgatcgtgccggtgatccatcaggcccagcacctttcgctcgccggcattgcg
gcgaagctgcaggatctgacctcacgggcgcgatcgaacgcgcttaacgccgcggacgtc
aggggcggtaccttcaccatttccaatcatgggatatccggatcactggtcgcggcgccg
atcatcatcaaccagccccaatcggcgatcctcggcgtcggaaagctcgagaagcgggtc
gtcgtccgtgaggtcgatggtgtcgacaccatccagatccgaccgatggcctatgtgtcg
ctgaccatcgatcaccgggcgctggacggccatcagacgaatacgtggctcacccatttc
gtccagaccctcgagagctggccccaatga

DBGET integrated database retrieval system