KEGG   Sinorhizobium fredii USDA 257: USDA257_c31570Help
Entry
USDA257_c31570    CDS       T02188                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    USDA257_c31570 (fucA)
Enzymes [BR:sfd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     USDA257_c31570 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3308907..3309611
Genome map
AA seq 234 aa AA seqDB search
MAETPTTDKLALRREMVDICRRMNSSGINQGTAGNLSVRAGDGFLITPSSMPYDTMQPED
LVEMDFNGTYVGHRPSSEWRFHRDILRARTDIDVVLHCHSIYATTLACHHKAIPSFHYMT
GIAGGTTIRCAGYATFGTQALSDNALVALKDRTACLLGQHGQISLGKTLESALWLAIEVE
TLSRIYVQALTLGEPPILPDDEMERVIEQMRRMSYGQAPDAESVNDVARPRGSE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaccccgacgaccgacaagctggcgctgaggcgcgagatggtggacatctgc
cggcggatgaattcgagcggcatcaaccagggcacggccggcaatctttcggtccgcgcc
ggcgacggattcctgatcacgccctcttccatgccctatgacacgatgcagccggaagat
ctggtcgagatggatttcaacggaacctatgtcggccatcggccgtcgtccgaatggcgt
ttccatcgggatatcctgcgcgcgcgcaccgatatcgacgtggtgctgcattgccactcg
atctatgcgacgacgctcgcctgccaccacaaggccattccgagcttccactatatgact
gggattgccggcggcacgacgatccgctgcgccggctacgccaccttcggcacgcaggcg
ctctccgacaacgcgctcgtcgcgcttaaggatcgcaccgcctgtctgcttggccagcac
ggccagatctcgctcggcaagacactcgaatcggcgctctggcttgcgatcgaagtggaa
acgctgtcgcggatctatgtccaggctctcaccctcggcgaaccgccgatcctgcccgac
gacgagatggagcgcgttatcgagcagatgcggcgcatgagctacggccaggcgcccgat
gcggagagcgtaaacgatgttgcccgcccgcgcggctccgagtga

DBGET integrated database retrieval system