KEGG   Sinorhizobium fredii USDA 257: USDA257_c31910Help
Entry
USDA257_c31910    CDS       T02188                                 

Gene name
cysQ1
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sfd00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3340917..3341723
Genome map
AA seq 268 aa AA seqDB search
MTPLCELFERIALEAGASILAVYEAGPTVCFKDDCSPVTEADERAEAIILDRLAAAFPHI
PVVAEEAVASGRVPDISCGRFFLVDPLDGTKEFINRRDDFTVNIALIEGNVPVAGIVYAP
AQRCAYVADRDRAEKLVFGTGTAVGHRQAIRVRARGPVMTAVASRSHNSLETEAFLAGHG
VTDYTSVGSSLKFCLLAEGRADVYPRFGRTMEWDTAAGNAVLNAAGGSVVRLDGSRLLYG
KMKQLDDSDFANPHFVAWADMSPVLAAL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccctttgcgaactgttcgagcgcatcgcgctcgaggccggcgcgtcgatcctc
gccgtctacgaggcgggcccgactgtctgcttcaaggatgattgttcgcccgtgaccgag
gcggatgagcgggccgaagcaatcattctcgacaggttggcggcagctttcccgcatatt
ccggtcgtcgccgaggaggccgtcgcctccggccgcgtccccgatatcagctgtggcagg
ttcttcctggttgatccgctcgacggaacgaaggaattcatcaaccggcgcgatgacttc
actgtcaatatcgccttgatcgagggtaatgtccctgttgccggcatcgtctacgcgccg
gcgcagcgctgcgcctacgtcgccgacagggacagggcggagaagcttgtcttcggcacc
ggcactgcggtcgggcatcggcaggcgatacgggttcgggcgcgcggtccggtgatgacc
gccgtcgccagccgctcgcacaacagcttggagaccgaggcgtttctcgccggtcacggc
gtgacggattacacctccgtcggctcgtcgcttaaattctgcctgctcgccgaaggcagg
gcggatgtctatccccgcttcggccgcacgatggaatgggatacggcggcgggcaatgcg
gtgctcaacgccgccggcggatcggttgtccggctggacggttctcgcctcctttacggc
aagatgaagcaactggacgacagcgatttcgcaaatccgcatttcgtggcctgggcggac
atgtctccggttttggcggctctttag

DBGET integrated database retrieval system