KEGG   Sinorhizobium fredii USDA 257: USDA257_c34550Help
Entry
USDA257_c34550    CDS       T02188                                 

Gene name
folE
Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sfd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3620740..3621357)
Genome map
AA seq 205 aa AA seqDB search
MDAIVKNFPVLDDTSGRPTQKEAEEAVRVLLRWAGEDPTREGLKDTPTRVVKSYREIFGG
YDLVAEDVLGRTFEEVSGYDDIVLEKDIPFYSHCEHHMVPIIGKAHVAYLPNGRVLGLSK
IARVVDIYARRLQTQESMTAQIARAIDETLAPRGVAVMIEAEHLCMAMRGIKKQGATTLT
TTFTGAFKTEPAEQARFMTMLRGFK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatagtaaagaatttccctgtgctcgacgacaccagtggtcggccgacgcag
aaagaagccgaggaagctgttcgcgtactgctgcgctgggcaggcgaagacccaacccga
gaaggcctgaaggacaccccgacgcgtgtcgtcaaatcctatcgggaaattttcggcggc
tacgacctcgtcgccgaggacgtgcttggccggaccttcgaagaagtctccggctacgac
gacatcgtcctcgagaaggacatcccgttctattcgcattgcgaacaccacatggtgccg
atcatcggcaaggcgcatgtcgcctatctgccgaacggccgcgtcctgggcctctccaag
atcgcccgtgtcgtcgatatctatgcgcggcgcctgcagacgcaggagtcgatgacggcg
caaatcgccagggccatcgacgagacgctcgctccgcgcggcgtcgctgtgatgatcgag
gccgagcatctgtgcatggcgatgcgcggcatcaagaagcagggcgcgacaacactgacg
accacctttaccggtgccttcaagacagagccggccgagcaggcccgtttcatgaccatg
ttgaggggcttcaagtaa

DBGET integrated database retrieval system