KEGG   Sinorhizobium fredii USDA 257: USDA257_c34740Help
Entry
USDA257_c34740    CDS       T02188                                 

Gene name
tpiA3
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    USDA257_c34740 (tpiA3)
   01230 Biosynthesis of amino acids
    USDA257_c34740 (tpiA3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    USDA257_c34740 (tpiA3)
   00051 Fructose and mannose metabolism
    USDA257_c34740 (tpiA3)
   00562 Inositol phosphate metabolism
    USDA257_c34740 (tpiA3)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    USDA257_c34740 (tpiA3)
Enzymes [BR:sfd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     USDA257_c34740 (tpiA3)
Exosome [BR:sfd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   USDA257_c34740 (tpiA3)
  Exosomal proteins of bladder cancer cells
   USDA257_c34740 (tpiA3)
  Exosomal proteins of melanoma cells
   USDA257_c34740 (tpiA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3637078..3637848
Genome map
AA seq 256 aa AA seqDB search
MTPDIRPLVAGNWKMNGTRASLDQIKAMAEGVKGELSAKVETLICPPATLLYVATALCDD
SPLMIGAQNCHQKQSGAHTGEISAEMIADCFGTHVIVGHSERRTDHAETDALVRAKTEAA
YVAELVAIVCIGETEEERKSGKTLDVLRRQLAGSLPDGATAENTVIAYEPVWAIGTGLTP
TVGDVEEAHAFMRSELVSRFGAEGGKMRILYGGSVKPSNAKELMGVANVDGALIGGASLK
AEDFLAIYRAYEELTA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgatatccgcccgctggttgccggcaactggaagatgaatggtacgcgtgct
tcgctggaccagatcaaggcaatggccgagggcgtcaagggcgaactttccgccaaagtg
gagacgctgatctgcccgccggcgacgctgctttatgttgcaaccgcactttgcgacgac
agtccgctgatgatcggcgctcagaactgccaccagaagcagtcgggcgcccacacgggc
gagatttccgctgagatgatcgccgattgcttcggcacgcatgtcatcgtcggccactcc
gaacgccgcaccgatcatgccgagaccgatgcgctggtacgggcgaagaccgaagccgcc
tacgtggcggaactcgtcgccatcgtctgcatcggcgagaccgaagaagaacgcaagagc
ggcaagacgctcgacgtcctgaggcgccagctcgccggaagcttgccggatggcgcgaca
gccgagaataccgtgatcgcctatgagccggtctgggcgatcggcacgggcctgacgccg
acggtgggagatgtggaagaggcgcatgccttcatgcgcagtgaacttgtctcgcgcttc
ggcgccgagggcggcaagatgcgcatcctctacggcggctctgtcaagccatcaaatgcc
aaggaactgatgggcgtcgccaatgtagacggtgcgctgatcggaggcgccagcttgaaa
gcggaagacttcctcgccatctaccgggcctatgaagaattgactgcgtga

DBGET integrated database retrieval system