KEGG   Sinorhizobium fredii USDA 257: USDA257_c35730Help
Entry
USDA257_c35730    CDS       T02188                                 

Gene name
pcm4
Definition
protein-L-isoaspartate O-methyltransferase Pcm (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sfd  Sinorhizobium fredii USDA 257
Brite
Enzymes [BR:sfd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     USDA257_c35730 (pcm4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3741006..3741620
Genome map
AA seq 204 aa AA seqDB search
MALRLRSAGVVNHDLLKAVEQTPRNNFCPPQYQDDVYSKRLIPLDCGSFMEGCDFAVRLL
HCLNIKPGQRILEVGTGSGFTAAVMGRIAERILTIDRYQTLVSSAQKNLEKTGMRNVVVR
HVDGSSGVPGEGTFDRILITAAFNSLPRMFSDHLVSGGTLLVPIMMSETQCRIVRVSRTG
SRFDREDLFDAPYLPIVPQLASFL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcgccttcgttccgccggcgtggtcaatcacgatctgctcaaggccgtcgag
cagaccccgcgaaacaatttctgccccccgcagtatcaggacgacgtctattccaagcgg
ttgataccgcttgactgcggttcgttcatggaaggttgcgacttcgccgttcgcctgctg
cactgcctcaatatcaagccgggccagcgcattctggaagtcgggacgggcagcggcttc
acggcggccgtgatggggcgtatcgcggaacgcattctgacgatcgaccggtatcagaca
ttggtgagttcggcgcagaagaacctcgaaaagaccggcatgcgcaatgtcgtcgtgaga
cacgtggacggcagttccggggtgccgggcgaggggacgttcgaccggattctcatcact
gccgccttcaacagcctgccccggatgttttccgatcatctcgtctccggcggcaccctg
ttggtgccgatcatgatgagcgagacccagtgccgcatcgtgcgggtcagccggacaggc
agccgcttcgatcgcgaagatctgttcgacgcgccttatctacccatcgtgccgcagctc
gcttcgtttctttag

DBGET integrated database retrieval system