KEGG   Sinorhizobium fredii USDA 257: USDA257_c37190Help
Entry
USDA257_c37190    CDS       T02188                                 

Definition
O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sfd  Sinorhizobium fredii USDA 257
Brite
Enzymes [BR:sfd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     USDA257_c37190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3879349..3880425)
Genome map
AA seq 358 aa AA seqDB search
MRSEYDMAAPAEGEKGTARRESLRSEHGQNANGAGVMQLLMTGDLSFSSEGCRYSLRHQR
EWAGGRKYLADGRRKVMTTNRRASLDEIRAFHARMMAVASNSAGERLERIFELVPREAFL
GPGPWQIKVNRRYVETPSADPCYVYQNVLVALDVTKGINNGEPLLHAALIGAAAPKAGEM
VVHVGAGTGYYTALLAMLVLPNGHVQAFEVDRRLADRARENLEPFDGVALTNDDATALPM
QSANLVYVSAGVVALPAHWLEALRPGGRLIFPWQANKRTGLAVLITRTTAGYKARPLMPA
WFIPCVGAPDSAECSKFPASADAWSIRSVWLTRDRSPDETAVAIYKDLWFSSADCQHF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagatccgaatacgacatggcggctccggctgagggagagaaaggcacggcgcgaagg
gaatcattgcgatcagagcatggacagaatgcgaacggagcaggcgtaatgcaactcctg
atgacaggagatcttagcttctcatctgagggctgtcgctatagcctacgtcaccaacgg
gagtgggcgggcggccgaaaatatcttgcggacggacggaggaaggtaatgactacaaat
cgccgtgccagcttggatgagatacgcgcattccacgcgaggatgatggcggttgccagt
aactcagcaggtgaacggcttgagcggattttcgagcttgtcccgcgcgaggcgttcttg
ggtcccgggccgtggcagatcaaggtcaatcggcgctacgtggagacccccagtgccgat
ccctgctacgtctatcagaatgtccttgtcgcactggatgtcacaaagggcatcaacaac
ggcgaaccactcctccacgcggccttaataggcgctgctgcccccaaagccggtgagatg
gtagttcatgttggggcgggaaccggctattacaccgcgctgctcgcgatgctcgtgctg
ccgaacgggcatgttcaagcttttgaggtagaccggcgcttagccgaccgggcgcgggaa
aacctcgagccgtttgacggagttgcgctcaccaatgacgacgcaacggctttgcccatg
cagagcgccaatctcgtctatgtgagtgccggcgtcgtggcgctcccagcgcactggcta
gaagcactgcgcccgggaggccggctaatctttccttggcaggcaaataagaggaccggt
cttgcagtcctgatcactcggacaaccgcaggctacaaagcgcgaccactaatgccggct
tggttcattccctgcgtcggtgcaccggatagtgccgaatgcagcaagttcccagcttcg
gccgatgcatggtcgatacgctcggtctggctgacgcgggatcgctcgccagacgagacg
gccgttgcaatctacaaggacctttggttttcaagtgctgactgccagcacttctaa

DBGET integrated database retrieval system