KEGG   Sinorhizobium fredii USDA 257: USDA257_c38320Help
Entry
USDA257_c38320    CDS       T02188                                 

Gene name
adhA
Definition
alcohol dehydrogenase AdhA (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    USDA257_c38320 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    USDA257_c38320 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    USDA257_c38320 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    USDA257_c38320 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    USDA257_c38320 (adhA)
   00626 Naphthalene degradation
    USDA257_c38320 (adhA)
Enzymes [BR:sfd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     USDA257_c38320 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3996257..3997279
Genome map
AA seq 340 aa AA seqDB search
MSMKAAVVREFGKPLVIEEVPIPQPGPGQVLIKYEATGVCHTDLHAAKGDWPVKPNPPFI
PGHEGVGYVAKLGAGVKRLKEGDRVGVPWLHTACGCCTPCRTGWETLCGSQQNTGYSLDG
TFAQYGLADPDFVGRLPGKLEFGPAAPVLCAGVTVYKGLKETEARPGEWVLVSGIGGLGH
MAVQYAKAMGMHVAAADIFPDKIELAEKLGADLVIDARAPDAVEEVQKRTGGVHGALVTA
VSPKAMEQAYRMLRSKGTMALVGLPPSQICLPVFDTVLKRITVRGSIVGTRQDLEEALEF
AGEGKVAAHFSWDKIENINAIFERMEEGKIDGRIVLDLNG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgaaagccgctgtggtccgcgagttcggtaagccgcttgtcatcgaggaagtc
ccgataccgcagccagggcctggccaggtcctcatcaaatacgaggcgacgggcgtgtgc
cacaccgatctgcatgccgccaagggcgattggccagtcaagccaaatccaccgttcatt
cccggccatgaaggggtgggctacgtcgccaagctcggcgcgggcgtcaaacggctgaaa
gagggggatcgggtcggcgtgccatggctgcacaccgcctgcggctgctgcacgccctgc
cgcaccggctgggagacgctttgcggcagccagcagaataccggctattcccttgacggc
acctttgcccagtatgggctcgctgacccggatttcgtcgggcggctgcctggcaagctg
gagttcggtccggcagcaccggtgctctgcgccggcgtcacggtctacaagggcttgaag
gagacggaggcgagacccggtgaatgggtcctcgtctccggcatcggcgggctcggccac
atggccgtgcaatatgccaaggccatgggcatgcatgtcgccgcggccgacatcttccct
gacaagattgagcttgccgagaagctcggcgccgacctcgtcatcgatgccagggcgccc
gatgccgtcgaggaggtgcagaagcggacgggcggcgtccacggagcgctggtcacggct
gtctcaccaaaggcgatggagcaggcttacaggatgctgcgctccaagggtaccatggcg
ctcgtcggtctgccgccgagccagatctgcctgccggtgttcgatacggttctgaagcgc
atcacggttcgcggctctattgtcgggacacgccaggatctggaggaagcgttggaattt
gccggcgagggcaaggtcgcggcccacttctcctgggacaagatcgagaacatcaacgcc
atcttcgagcgcatggaagaaggcaagattgacggccgtatcgttctcgacctgaacggt
tga

DBGET integrated database retrieval system