KEGG   Sinorhizobium fredii USDA 257: USDA257_c39060Help
Entry
USDA257_c39060    CDS       T02188                                 

Gene name
nosZ
Definition
nitrous-oxide reductase NosZ (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    USDA257_c39060 (nosZ)
Enzymes [BR:sfd01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     USDA257_c39060 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4062959..4064878)
Genome map
AA seq 639 aa AA seqDB search
MSNEETKMRLNRRQMLGTTAFVAAAGAVGAGGALTLSGGMATAAKAQEASAGSYEVKPGE
LDEYYVFFSSGQSGEIRVVGAPSMREMMRIPVFNRCSATGWGQTNESRKILTEGLLPETV
EFLKDRGGVYTNGDLHHPHPSFTEGTYDGRYLFANDKANTRVCRIRLDVMKCDKIIQLPN
QHTVHGLRVQKYPKTGYVFCNGEDRVPIPNDGKVLDDHKQYSAIFTAVDGETMKVAWQVM
VDGNLDNVDADYQGKYCFATCYNSEEGVNLAEMMGSEQDWVVVFNLKRIEEAVAKGDYKE
MGGVPVLDGRKGSPYTRYIPVSNSPHGINTAPDGIHVVANGKLSPTVTVFDVRKFDDLFD
DKIKPRDTVVAEPELGLGPLHTAYDGKGNAYTTLFIDSQVCKWNIEDAKRAFAGEKVDPI
RQKLDVHYQPGHNHTSMGQTKDADGKWLISLNKFSKDRYLNVGPLKPENDQLIDISGDEM
VIVHDNPTFAEPHDATIVHASKINPVHVWNRDDPVFADAVAQAKADNIDLLVDSEVIRDG
NKVRVYMTSAAPAFGLESFTVKQDDEVTVYVTNIDEVEDLTHGFSIINYGINMEVAPQAT
ASVTFKASKPGVYWYYCSWFCHAMHMEMKGRMFVEPTAA
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgaagaaaccaagatgcgtctgaacagacgacaaatgctcggcaccaccgcc
ttcgtggcggcagccggtgccgtgggcgccggtggcgcgctgacgctttcgggcggcatg
gcgaccgcggcgaaggcgcaggaggcgtccgcgggaagctacgaggtgaagccgggagaa
ctcgacgaatactatgtcttcttctcgtcggggcagtcgggtgaaattcgtgtcgtcggc
gcgccgtcgatgcgcgaaatgatgcggattcccgtcttcaaccggtgcagcgccaccggc
tggggccagacgaacgaaagccgcaagatcctgaccgaaggcctgcttcccgagaccgtg
gagttcttgaaggaccggggcggcgtgtacacgaacggcgaccttcatcatccgcatccg
tcgttcaccgagggcacttacgacggccgctaccttttcgccaacgacaaggcgaacacg
cgcgtctgccgcatccgactcgacgttatgaagtgcgacaagatcatccagcttcccaac
cagcacacggtccacgggctccgggtccagaagtatccgaagaccggctacgtcttctgc
aacggcgaggatcgcgtgccgatcccgaacgacggcaaggtgctcgacgaccacaagcag
tacagcgcgatcttcaccgccgtcgacggcgagacgatgaaggtcgcctggcaggtcatg
gtcgacggcaacctcgacaacgtcgacgccgactaccagggcaagtactgcttcgcaacc
tgctacaactccgaagaaggcgtcaatctcgccgagatgatgggcagcgagcaggactgg
gtcgtcgtcttcaacctcaagcggatcgaggaagcggtcgccaagggcgactacaaggaa
atgggcggcgtgccggtcctcgacggccgcaagggatcgccctacacgcgctacattccg
gtctccaacagccctcacggcatcaacacggcgcccgacggcatccacgtggttgcgaac
ggcaagctgtccccgaccgtgaccgtgttcgacgtgcgcaagttcgacgatctgttcgat
gacaagatcaagccgcgcgacaccgtcgtcgctgaacccgaactcggcctcggcccgctg
cacacagcctacgatggcaagggcaacgcctacacgaccctgttcatcgacagccaggtg
tgcaaatggaacatcgaggacgccaagcgggccttcgccggcgagaaggtcgatccaatc
cgccagaagctcgacgtccactaccagccgggccacaaccacacatccatgggacagacc
aaggatgccgatggcaagtggctgatctcgctgaacaagttctccaaggaccgctatctg
aacgtcggtccgctgaagccggagaacgatcagttgatcgacatctccggggacgagatg
gtcatcgtgcatgacaaccctacgttcgccgagccgcatgacgcgaccatcgtgcacgcc
tccaagatcaacccggtgcacgtctggaatcgcgacgacccggtcttcgccgacgcggtc
gcccaggccaaggctgacaacatcgatctgctggtcgattcagaggtcatccgcgacggc
aacaaggtccgtgtctacatgacgtccgcggctccggccttcggtctggagagcttcacg
gtgaagcaggacgacgaggtcaccgtctacgtgaccaacatcgacgaggtcgaggacctg
acgcacggcttctccatcatcaactacggcatcaacatggaggtggcgccgcaggcgacc
gcttcggtgaccttcaaggccagcaagcccggcgtctactggtactattgctcctggttc
tgccatgccatgcacatggagatgaagggccggatgttcgtcgagcccacggcggcatga

DBGET integrated database retrieval system