KEGG   Sinorhizobium fredii USDA 257: USDA257_c40850Help
Entry
USDA257_c40850    CDS       T02188                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    USDA257_c40850 (folK)
Enzymes [BR:sfd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     USDA257_c40850 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4260866..4261438)
Genome map
AA seq 190 aa AA seqDB search
MLRSQGSWTTWKSRSSMPRDKKWRRATLGLGGNIGDPRRAMADALRELDDRPDCRVAAVS
RLYRTPPWGKTDQDWFFNACAAVETTRDPEALLETCLEIERVMKRVRKERWGPRTIDIDL
LTFEGASLASDKLQLPHPRMTERGFVLMPLADFAAELEVAGRTVGEWLADADVTGIEVAD
EKADWWRAYN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgctccggtcccaggggtcctggactacgtggaagtcacggtcgagcatgccgcgggat
aagaagtggcggcgcgctacactggggctgggtggcaatatcggcgatccgcgccgtgct
atggcggacgccctgcgggagctggacgatcggccggattgccgggtcgcggcagtttcg
cggctctaccggacgccgccctggggcaagacggaccaggattggttcttcaatgcctgc
gcagcggtcgaaaccacgcgcgatccagaagcgcttcttgaaacctgcctcgagatcgag
cgggtcatgaagcgcgtccgcaaggagcgctgggggccgcgcacgatcgatattgatctc
ctgaccttcgagggagcgagcctggccagcgacaagctgcagttgcctcatccacgcatg
acagagcggggtttcgtgttgatgccgcttgccgattttgcggccgaactcgaagtcgcg
ggcagaacggtcggtgagtggctggcggacgcagacgtgacaggaatcgaagtggccgac
gagaaggccgactggtggcgggcctacaattga

DBGET integrated database retrieval system