KEGG   Sinorhizobium fredii USDA 257: USDA257_c40870Help
Entry
USDA257_c40870    CDS       T02188                                 

Gene name
sul
Definition
dihydropteroate synthase Sul (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    USDA257_c40870 (sul)
Enzymes [BR:sfd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     USDA257_c40870 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4261745..4262659)
Genome map
AA seq 304 aa AA seqDB search
MPTRMALLKAADRPKMTYDPFRISHWQLAHGRTLELGPRGVLMAIINVTPDSFSDGGRFA
DATAAVATAMRAIDDGAAILDIGGESTRPDADPVDAAEEQARILPVIEALARQTDGIISV
DTYRADTARLAVKAGAHIVNDVHGLQREPAIAQVAAETGAGLCVMHTGRDRQKLGDVVED
QFHFLSRSLQIAAEAGVARDRIVLDPGYGFAKDADENLELMARFAELHRLGLPFLVGTSR
KRFIGAVTGREAKDRDAGTAATTALLRVAGAAIFRVHDVAINRDALAMADAMLIAKNSRR
DMKP
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgaggatggcgctgcttaaagccgcggaccgcccgaagatgacctatgacccc
ttccgaatatctcattggcaattggcgcatgggcgcacgctggaactgggaccgcgcggt
gtcctgatggcgataatcaatgtgacgccggattccttttccgatggtggccgctttgcc
gatgccacggctgctgtcgccacggcgatgcgtgccatcgatgatggggcggcgatcttg
gacatcggcggggagtcgacccgccccgacgcggatccggtcgatgccgccgaggaacag
gcgcgcattctgccggtcatcgaagcattggcccgccagacggatggaatcatctcggtc
gacacctatcgcgccgatacggcgcgcctggcggtgaaagccggcgcgcatatcgtcaac
gatgtgcacggtctgcagcgagagccggcgatcgcgcaagtcgctgccgaaacaggcgcc
ggactttgcgtcatgcatacggggcgcgatcgtcagaagctcggcgatgtcgtcgaggat
cagttccattttctgagtcgatcgctgcagattgccgccgaggcaggcgttgcgcgcgac
cggatcgttcttgatcccggctatggcttcgccaaggacgcagacgaaaatctggaactc
atggcgcgttttgcggaactgcaccggctcggcctgccgttcctggtcggcacgtcgcgc
aagcgcttcatcggcgccgtcaccggccgcgaggcgaaagaccgcgacgccggtaccgcc
gcgacgactgcgctcctcagggttgctggagcggcgatttttcgggtgcatgatgtcgca
atcaacagggatgcactggcgatggcggatgctatgctcatcgcaaagaacagccgacgg
gacatgaagccatga

DBGET integrated database retrieval system