KEGG   Sinorhizobium fredii USDA 257: USDA257_c41340Help
Entry
USDA257_c41340    CDS       T02188                                 

Gene name
pleD3
Definition
response regulator PleD (EC:2.7.7.65)
Orthology
K13590  
diguanylate cyclase
Organism
sfd  Sinorhizobium fredii USDA 257
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4316654..4317724
Genome map
AA seq 356 aa AA seqDB search
MQTATSNKTPTPDIAAQITHAMRMMGVAPIPRNYELYYEAYLGSNPQLSKELAALGSRAT
QDELDAIGSRYFSHIHHSRGIERAHSTLAEKLTELVTLLRDEQYALESYNRVLDEAYLNI
TNKSAASADILRHAIDILSEATADTMNQGKERVQTVVQKSFEMEAIRQELDEYKRIANTD
SLTRLGNRRAFDETLAAVYNNEQLRNYTGLLVVDIDHFKKVNDSFGHPVGDKILSTVGTV
IRANLRRDAFVARTGGEEFAVILNDSTQEECLQVADRIRSVLSNTPFKNSKTGVNYGPIT
LSVGVCMATAADDPLDLYHKADIALYAAKNSGRNRTVLFEDGMRKDSGRNWLIYRR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcagacggcaacctcgaacaagacgccgactcccgatatcgctgcgcagattacccat
gcaatgcgtatgatgggcgtcgcgccgataccgcgcaattacgagctttactacgaggcc
tatctgggctcgaacccgcaactgtcgaaagaacttgcggcgctcggcagccgcgccaca
caggacgagctcgacgccatcggatcgcgctatttcagccatatccaccattcgcgcggg
atcgagcgtgcccatagcacgctggcggaaaagctgaccgaactggtcactctcctgcgg
gacgaacaatacgcactcgagagctacaacagggttctcgacgaggcttacctcaacatc
accaacaagagtgccgcgagcgccgacatcctccgccacgcgatcgacattttgagcgaa
gcgaccgccgatacgatgaaccagggcaaggagcgtgttcagacggtcgttcagaaatcc
ttcgagatggaagcgattcgccaggagctcgatgagtacaagcgcattgccaataccgat
tcactgacgcggctcggcaatcggcgtgccttcgacgagaccctcgccgcggtctacaac
aatgagcaattgcgcaactacacgggtctgctcgtcgtcgacatcgaccatttcaagaag
gtcaatgacagcttcggccacccggtcggggacaagatcctctccaccgtcggcaccgtc
attcgcgccaatctccggcgcgacgccttcgtcgcccgcaccggcggcgaggagtttgcc
gtcatcctgaacgacagcacgcaggaggaatgcctgcaggtcgccgaccgcatccgcagc
gttctgtcaaacacgccgttcaagaactccaagactggcgtcaactacggcccgatcacc
ctctcggtcggcgtctgcatggcaacggcggcggacgatccactcgatctctaccacaag
gccgatatagcgctctacgcggccaagaattccggtcgcaacaggacggtcctcttcgag
gacggcatgcgtaaggattccggacggaactggttgatctatcgccgctaa

DBGET integrated database retrieval system