KEGG   Sinorhizobium fredii USDA 257: USDA257_c44450Help
Entry
USDA257_c44450    CDS       T02188                                 

Definition
dhfrIII: dihydrofolate reductase type 3 (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    USDA257_c44450
   00670 One carbon pool by folate
    USDA257_c44450
Enzymes [BR:sfd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     USDA257_c44450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4614820..4615359)
Genome map
AA seq 179 aa AA seqDB search
MTDARPDPKIVIVVAVATNGVIGREGDLPWRLSTDLKRFKALTIGKPVIMGRKTWVSLGR
PLPGRPNIVISRDPSFTAAGAETVSSVPEALERARTHAAALDADEICIIGGGEIYRQSVD
LADVLHVTEVQAEVEGDTRFPPIDPRSFEKVFQEDLPRGEKDSHAMHFVTWRRREALSK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgcaagaccggacccgaagatcgtcatcgtcgttgcggtcgcgaccaatggc
gtgatcggacgcgagggcgacctgccgtggcggctttcaacggatctgaagcgtttcaag
gcgttgacgatcggcaagccggttatcatgggacgcaagacctgggtgtcgctcggtcgt
ccgctacccggccggccgaacatcgtcatcagccgcgaccccagtttcacggctgccgga
gccgagactgtctcgtcagttccggaagcgctcgagagggcgcggacgcatgccgcggcg
ctcgatgccgacgagatctgtatcatcggcgggggtgagatttaccggcagtcggtcgat
ctcgccgacgtgctgcacgtgacggaggtgcaggcggaggtggagggcgatacgcgtttc
ccgccgatcgatcctcggtctttcgagaaggtattccaagaggacctgccgcgtggcgag
aaggacagccatgcgatgcactttgtcacgtggcggcgacgcgaagcgctgtcaaaatag

DBGET integrated database retrieval system