KEGG   Sinorhizobium fredii USDA 257: USDA257_c47460Help
Entry
USDA257_c47460    CDS       T02188                                 

Gene name
glpK3
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sfd00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4916868..4918382)
Genome map
AA seq 504 aa AA seqDB search
MLAEEGHMGGYILAIDQGTTSTRAIVFDGKQQVAGASQKEFRQYFPKSGWVEHDPEEIWE
TVLFTVRQAIEKAGIAASDLAAIGITNQRETVVVWDRETGKPIHNAIVWQDRRTASFCDK
LKKKGLEKTFTKKTGLLLDPYFSGTKLNWLLTNVKGAQARAAKGELCFGTIDTFLIWRLT
GGKSFATDATNASRTLIYSIVDNSWDDQLLEILRIPRAMLPEVKDCAADFGITEASFLGA
AIPILGVAGDQQAATIGQACFKPGMLKSTYGTGCFALLNTGKDIVRSKNRLLTTIAYRLN
GKTTYALEGSIFVAGAAVQWLRDGLKVIKAAPDTGTLAESADPTQEVYLVPAFTGLGAPH
WDPDARGAIYGMTRNTGPAEFARAALESVCYQTRDLLDAMHRDWRSNGKDTVLRVDGGMV
ASDWTMQRLSDLLDAPVDRPVILETTALGVAWLAGSRAGVWPNQEEFSKSWARDRRFEPQ
MDGTTRKGKLKGWRSAVKRTLMAA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgccgaggaggggcatatgggcggatatattcttgcaatcgatcagggtacgacg
tccacgcgggcgatcgttttcgacggcaagcagcaggtcgcgggcgccagccagaaagaa
ttcaggcaatattttccgaaatcgggctgggtcgagcacgacccggaggaaatctgggaa
acggtcctcttcaccgttcggcaggcgatcgagaaagccggcattgccgcaagcgatcta
gcggcgatcggcatcaccaatcagcgcgagacggtggtcgtttgggatcgcgagaccggc
aagccgatccacaacgcgatcgtctggcaggatcgccgcaccgcctcgttctgcgacaag
ctcaagaagaaaggtctcgaaaagaccttcaccaaaaaaacgggacttctgctcgatccg
tatttttccggcacgaagctcaactggctgcttaccaatgtgaagggagcgcaggcgcgc
gccgcaaagggcgagctgtgcttcggcaccatcgacacgttcctcatctggcggctcacc
ggcggcaaatccttcgcgaccgatgcgaccaatgcttcccgcacgttgatctacagtatc
gtcgacaatagctgggacgaccagctcctcgaaatcctgcgcattccgcgggcgatgctg
ccggaagtgaaggattgcgccgccgacttcggcatcacggaggcgtccttcctcggggcg
gcgatcccgatcctcggagtcgccggcgaccagcaggcggcgacgatcggccaggcctgc
ttcaagcctggcatgctgaaatcgacctatggcaccggttgcttcgcgctgctcaacacc
ggcaaggatatcgttcgctccaagaaccgactgctgaccaccatcgcctatcgtctcaat
ggcaaaacgacctatgcgctcgaaggctcgatcttcgttgcgggcgctgccgtccaatgg
ctgcgcgacgggctcaaggtcatcaaggcggcgcccgacaccggcacgcttgccgagagc
gccgatccgacgcaggaggtctacctcgtgccggcctttaccgggctcggcgcgccgcat
tgggatccggatgcccgcggcgcgatctatgggatgacgcgcaacaccggtccggccgag
ttcgcccgcgccgctctggaatctgtctgctaccagacacgcgatctgctcgacgccatg
cacagggactggcgcagcaacggcaaggatacggtgctccgcgtcgacggcggcatggtc
gcatccgactggacgatgcagaggctctccgatcttctcgatgcccccgtcgatcgcccg
gttatcctcgagacgacagcgctcggggtcgcctggcttgccggcagccgtgccggcgtc
tggcccaaccaggaggaattctccaagtcctgggcccgcgaccggcgcttcgagccgcag
atggatgggacgacccgcaaggggaaactcaaaggctggcgcagcgcggtgaagcggacg
ctgatggcggcttag

DBGET integrated database retrieval system