KEGG   Sinorhizobium fredii USDA 257: USDA257_c47470Help
Entry
USDA257_c47470    CDS       T02188                                 

Gene name
bdhA2
Definition
D-beta-hydroxybutyrate dehydrogenase BdhA (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    USDA257_c47470 (bdhA2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    USDA257_c47470 (bdhA2)
Enzymes [BR:sfd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     USDA257_c47470 (bdhA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4918666..4919442
Genome map
AA seq 258 aa AA seqDB search
MTKTAVITGSTSGIGLAIAKAFAKSGANIVLNGFGSADEIRTVTDEVAGLGSGTVLYHPA
DMTKPAEIADLMATAVSRFGGADILVNNAGVQFVEKVEDFPVEQWDRIIAINLSSSFHTI
RAAIPAMKQNGWGRIVNIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAENGITVNS
ICPGYVLTPLVEKQIPDQARTRGITEEQVINEVMLKGQPTKKFITVEQVASLALYLASDE
AAQITGTHVSMDGGWTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagacagcggtcataacgggttcgacgagcggcatcgggctggccatcgccaag
gcctttgcgaagagcggcgccaatatcgtgctgaacggtttcggttcggctgacgagatc
aggacggtgacggacgaggtcgcaggcctcggttccggcacggtgctctatcaccccgcc
gatatgacgaaaccggcagaaatcgccgacctgatggcaaccgccgtctcgcgcttcggc
ggagccgacatcctcgtcaacaatgccggtgtccaattcgtcgaaaaagtcgaggatttc
cccgtcgagcaatgggaccggatcatcgccatcaatctctcctcctccttccacacgatc
cgggcggcgattcctgccatgaaacagaacggctggggccgcatcgtcaatatcgcctcg
gcgcacggcctcgtcgcctcgcccttcaagtccgcctatgtggcagccaagcatggtatc
atgggtctcacgaagaccgtggcgctcgaggtggcggaaaacggcatcaccgtgaactcg
atctgccccggctatgtgctgacgccgcttgttgaaaagcagataccggaccaggcgaga
acgcgcggcatcaccgaggagcaggtgatcaacgaggtgatgctcaagggccagccgacg
aagaagttcattactgtcgagcaggtcgcctcgctggcgctctatcttgccagcgacgag
gcagcccagatcaccggcacgcatgtctcgatggacggcggctggacggcgcaatag

DBGET integrated database retrieval system