KEGG   Sinorhizobium fredii USDA 257: USDA257_c47860Help
Entry
USDA257_c47860    CDS       T02188                                 

Gene name
mauG
Definition
methylamine utilization protein MauG
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sfd  Sinorhizobium fredii USDA 257
Brite
Enzymes [BR:sfd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     USDA257_c47860 (mauG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4964207..4965304)
Genome map
AA seq 365 aa AA seqDB search
MDDKLVAAGKLLFQSKKMSLDHETACATCHVDRFGSADGIPNAIGTEGHGEGVERLLAGG
DIIPRNTLPFWGRGGVGFDVFFWDGKVDKSSGTVVSQFGDLNPSDDPLVVAAHLPPVEIG
EMVTDSKDNEPLKTENVSTAAAVYDQLLDRLLKDDEINSALVAATGKSANEIEFLDVASA
IAAFIRDNFKLQSTRFHDFVFADGKMSERENAGGLIFYGKARCSTCHNGAYFSDLEFHAV
PFPQSGFGKNGFGVDYGRFNVTLNPDDRYRFRTPPLFNVSKTAPYSHSGSIMKLGDAIRV
HVDPFAVYDPSRMSAVQRAEYYQALKVWSDEPLVGVTLDDAEIDALTAFLRTLEFDSASP
VQVSD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtggacgataagctcgtggcggccggaaagctcttgttccagtcgaaaaaaatgtcactc
gatcacgagacagcttgcgcgacctgtcatgttgaccgttttggatcagcagacggtatc
cccaatgcgattggcaccgagggacatggagagggcgtcgaacgcttgctggctggcggc
gacatcattcccaggaatacactgccgttttggggacgaggtggcgttgggtttgatgtg
ttcttttgggatgggaaagtcgacaagtcatcgggaacagtcgtcagccaatttggtgac
ctgaatccttcagatgatccgctggtggttgctgcccacctgccccctgtcgaaatcggc
gaaatggttaccgacagcaaggacaacgagccccttaaaacagaaaacgtctcgacggcg
gcagcagtctacgatcaactgctggaccgcttgctaaaggacgatgagatcaactcggcg
ctcgttgcggcaaccggaaaatcggccaatgagatcgagtttcttgatgttgcatctgcc
attgcggcgttcattcgggataacttcaaactccaatcgacccgatttcatgacttcgta
tttgccgacggcaagatgtccgaacgggaaaatgcgggcggcctcatcttctacggaaaa
gctcggtgctcgacctgtcacaacggggcttatttctcggacttggaattccacgcagtg
ccgttcccgcagagtggctttggaaagaacggatttggcgtcgactacggccgattcaat
gtgacgttaaatccggatgaccgttaccggttccggacgccgccgctgttcaatgtatcg
aagaccgcaccctattctcactcagggtcgatcatgaagctgggagacgcgatacgcgtg
cacgttgatccgttcgcagtctacgacccctctcgcatgtctgccgtgcagagagccgag
tattaccaggcgctgaaggtttggtcggatgagccgttggtcggggtgacgcttgatgat
gcagagatcgacgcgctgactgcattcctgaggacgcttgaattcgacagtgcgtcgccg
gtccaagtgagcgactaa

DBGET integrated database retrieval system