KEGG   Sinorhizobium fredii USDA 257: USDA257_c49500Help
Entry
USDA257_c49500    CDS       T02188                                 

Gene name
cysQ2
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    USDA257_c49500 (cysQ2)
Enzymes [BR:sfd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     USDA257_c49500 (cysQ2)
Transfer RNA biogenesis [BR:sfd03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    USDA257_c49500 (cysQ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5124943..5125716
Genome map
AA seq 257 aa AA seqDB search
MEVLERSALAAGRAIMEIYNTGPAVTYKADTSPVTDADHRAERIILDDLATAFPDIPVIA
EEAVAAGHAPHIAGKPFFLVDPLDGTKEFVERNSHFTVNIALIENGAPVAGVVHAPALGV
IYATSGGVAFKATVEDNRICGSWQPIGCRKCGDRPLALTSRWHNSAETLVYLAEHRITDH
EAVGSSLKFCLLAEGYADIYPRFSRTMEWDTAAGDAILRAAGGETLAIDGGPLAYGKRNQ
PNDSDFANPWFISRGTA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttggaagtattagaaagatcggcgcttgcggccgggcgggcgatcatggaaatctacaat
accggcccagccgtgacctacaaggcggacacctcgccggtcaccgacgcggatcatcgt
gccgagcgcatcatccttgacgatctggccaccgcctttcccgacataccggtcatcgcc
gaggaagccgttgccgccgggcatgccccgcacatcgccggcaagccattcttcctcgtc
gatcctctcgacggcaccaaggaattcgtcgagcgtaacagccacttcacggtcaacatt
gcgcttatcgaaaacggcgctccggtcgcaggcgtcgtccatgcgccggcactcggagtg
atctatgcgacaagcggcggagtggccttcaaggcaacagtagaagacaaccggatatgt
ggctcatggcagcctatcggctgccgcaaatgcggcgatcggccactcgctctgacgagc
cgctggcacaacagcgccgaaacgctcgtctatctcgctgaacaccgcatcaccgaccat
gaggccgtcggctcgtcgctgaagttctgcctgctcgccgagggctacgccgacatctat
ccgcgcttcagtcgcacgatggaatgggataccgccgccggcgatgcgatcctgcgggcg
gcgggtggggaaacgctggcgatcgacggcgggccgcttgcctatggcaagcgcaaccag
ccaaacgacagcgacttcgccaatccctggttcatctcgcgcggcacggcgtga

DBGET integrated database retrieval system