KEGG   Sinorhizobium fredii USDA 257: USDA257_c49760Help
Entry
USDA257_c49760    CDS       T02188                                 

Definition
(GenBank) cytochrome c2
  KO
K08738  cytochrome c
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd01100  Metabolic pathways
sfd01120  Microbial metabolism in diverse environments
sfd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    USDA257_c49760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 TFIIS_C
Motif
Other DBs
NCBI-ProteinID: AFL53510
UniProt: I3XCA4
Position
5156817..5157203
Genome map
AA seq 128 aa AA seqDB search
MRIAVVALCFSALFLCPVAGHAQEGDADAGATVFKKCTACHVVDKDQNKVGPSLMGVIGR
TAGTHADFKYSQAMVEAGKGGLVWDEATLSDYLRNPKAKIKGTKMVFPGLKKDEEIANVI
AYLKQHPK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgctgttgttgccctatgtttttcggcactctttctctgtccggttgccggc
catgcccaggagggcgatgctgacgccggagccaccgtcttcaagaaatgcaccgcctgc
cacgtcgtcgacaaggaccagaacaaggtcgggccgtcgctcatgggtgtcatcggcagg
actgccggcactcatgcggactttaagtattcacaagccatggtcgaggcgggtaagggc
gggctcgtctgggacgaggcgactttgagcgactatctccgcaatccgaaggcgaagatc
aaaggcacaaaaatggtctttcccgggctcaagaaggacgaggagatcgccaacgtgatc
gcctatctcaagcaacaccccaaatag

DBGET integrated database retrieval system