KEGG   Sinorhizobium fredii USDA 257: USDA257_c50400Help
Entry
USDA257_c50400    CDS       T02188                                 

Gene name
ytcI
Definition
acyl--CoA ligase YtcI (EC:6.2.1.-)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sfd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sfd00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sfd00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sfd00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:sfd00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5232768..5234447)
Genome map
AA seq 559 aa AA seqDB search
MLAAAANFCRGRAMLPKIESYEELYREFRWRIPEAFNIGVAVSDAWAARDAERVCLQHFS
PDGAHRSLTYGAFAARSSAFAGGLAAHGIKPGDRVAILLPQGFEAAIAHAAIYKLGAVAL
PLALLFGVEALEYRLRDAGARAIVTNRFGYERLAAIRGALPKLRLVVLAEEEELPGTVLF
DDLVAGEGSFAAADTGPDDPALMIYTSGTTGPPKGALHGHRVLLGHLPGFQFHHHFLPQP
GDRMWTPADWAWAGGLLNALLPSLFFGVPMVSSPAQKFDPHIAFRIMEEMDVRNAFIPPT
ALRLLKSVDRPRARYKLNLRTIASAGEALGRETFEWAKEALGIEVSEFYGQTECNIVISS
AADLGVLKPGSMGKAAPGHEVAIIDGEGRVLPPGTTGQVAVRRPDPVMFLGYWRNDKATE
AKFIGDWMTTGDQGVMDAEGYFTFFGRDDDVITSSGYRIGPGEIEDCLAGHPDVQMAAAI
GKPDPIRTEIVKAYVVLKQGVAADDETAAAIRGWVKNRLSMHEYPREIEFVDSLPLTTSG
KVIRRLLRERAAAEITGGF
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgttagctgctgcagcaaatttctgtcgcggcagggccatgttaccgaagatcgagagc
tatgaggaactctatcgcgaatttcgctggcggattccggaggcgttcaacatcggcgtc
gccgtcagcgatgcgtgggcggcgcgggatgcggagcgtgtctgccttcagcatttcagc
cccgacggcgcgcatcggtcgctgacctatggtgcctttgcggcccgctcctcggccttc
gccggcgggcttgccgcgcatggcatcaagccgggcgatcgcgtcgccatcctgctgccg
cagggtttcgaggcggcgatcgcccatgcggcgatctataagctcggcgcggtcgcccta
ccgctcgcgctgctctttggggtcgaggcgctcgagtaccggcttcgcgatgcgggggcg
agggcgatcgtcaccaaccggttcggctacgagcggcttgcggcgatccggggcgcgctg
ccgaagcttcggctggtcgtgcttgcggaagaggaggaactgcccggcacggtgcttttc
gatgatctggtagcaggcgaaggcagttttgctgccgccgataccgggccggacgatccg
gctctgatgatctatacgtccgggacgaccgggccgccgaaaggcgccttgcacggccat
cgcgtgctgctcggtcatctgcccggcttccagttccaccatcacttcctgccgcagccg
ggcgaccggatgtggacgccggccgattgggcctgggcaggcggtcttctcaacgcactc
ttgccgtcgctgttcttcggcgtgccgatggtctcctcgccggcgcagaagttcgatccg
cacatcgcgttccggatcatggaagagatggacgtgcgcaacgccttcattccgccgacg
gcactcagactgctgaaatccgtcgatcgcccgcgcgcccgctacaagctcaatctgagg
acgatcgcctcggcgggggaagcgctcgggcgagagacctttgaatgggcgaaagaggcg
ctcggcatcgaggtcagcgaattctacggtcagacggaatgcaacatcgtcatctcgtcg
gcagccgacctcggcgtcctgaaacccggctcgatgggcaaggccgcacctggccacgag
gtggcgatcatcgacggcgagggtcgggtgctgccgccgggcacgacagggcaggtcgcc
gtcaggcgccccgatccggtgatgttcctcggctattggcgaaacgacaaggctaccgag
gcgaagttcatcggcgactggatgacgaccggcgaccagggcgtcatggatgcggagggc
tatttcaccttcttcggccgcgacgacgacgtcatcacttcgtccggctatcgcatcggc
ccaggcgagatcgaggattgcttggcggggcacccggacgtccagatggccgcggcgatc
ggcaagccggatccgatccgcaccgagatcgtcaaggcctatgtggtgctgaagcagggc
gtggcggccgatgacgagactgcggctgcgatccgcggctgggtcaagaacaggctgtcg
atgcacgaatatccgcgcgagatcgaattcgtcgacagcctgccgctcaccacctcgggc
aaggtgatccggcggctcctgcgggagagggccgcagcggagatcaccggcggtttttga

DBGET integrated database retrieval system