KEGG   Sinorhizobium fredii USDA 257: USDA257_c52730Help
Entry
USDA257_c52730    CDS       T02188                                 

Gene name
glsA2
Definition
(GenBank) glutaminase 2
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00220  Arginine biosynthesis
sfd00250  Alanine, aspartate and glutamate metabolism
sfd00471  D-Glutamine and D-glutamate metabolism
sfd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    USDA257_c52730 (glsA2)
   00220 Arginine biosynthesis
    USDA257_c52730 (glsA2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    USDA257_c52730 (glsA2)
Enzymes [BR:sfd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     USDA257_c52730 (glsA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AFL53798
UniProt: I3XD42
Position
5468135..5468584
Genome map
AA seq 149 aa AA seqDB search
MELLDPFFDPQSSYVSTGSLPPSDHVARLVTQAHERFGSVTLGQNSQVYPALARVPNNLF
GICVVSVDGRVFAVGDAEHEFTIMIVSKPFIFALICDVIGATGARERIGVNATGYAFNSI
AGIERNAEGRSNPMVNVCARAPDAASSAR
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggagctactggaccccttctttgaccctcagagctcctatgtctcgacagggagcctt
ccgccgtccgatcacgtcgcacgtctggtaacgcaagcccacgaacgcttcgggtcagtc
actctggggcagaactcccaagtgtatccggcgcttgcccgcgttccgaacaatctgttc
ggaatttgcgtcgtgagcgtggatgggcgcgtgtttgcggtcggagatgcggaacacgaa
ttcaccatcatgatcgtgtccaagccgttcatctttgcattgatctgcgatgtgatcggc
gcaaccggcgcgcgtgagcggattggcgtcaatgcgaccggctacgcattcaactctatt
gccggcatcgagcgcaacgcggaaggacgcagcaatccgatggtcaatgtctgcgctcga
gctccagatgctgcgtcgtcagcacgatga

DBGET integrated database retrieval system