KEGG   Sinorhizobium fredii USDA 257: USDA257_c52730Help
Entry
USDA257_c52730    CDS       T02188                                 

Gene name
glsA2
Definition
glutaminase 2 (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sfd00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sfd00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:sfd00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5468135..5468584
Genome map
AA seq 149 aa AA seqDB search
MELLDPFFDPQSSYVSTGSLPPSDHVARLVTQAHERFGSVTLGQNSQVYPALARVPNNLF
GICVVSVDGRVFAVGDAEHEFTIMIVSKPFIFALICDVIGATGARERIGVNATGYAFNSI
AGIERNAEGRSNPMVNVCARAPDAASSAR
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggagctactggaccccttctttgaccctcagagctcctatgtctcgacagggagcctt
ccgccgtccgatcacgtcgcacgtctggtaacgcaagcccacgaacgcttcgggtcagtc
actctggggcagaactcccaagtgtatccggcgcttgcccgcgttccgaacaatctgttc
ggaatttgcgtcgtgagcgtggatgggcgcgtgtttgcggtcggagatgcggaacacgaa
ttcaccatcatgatcgtgtccaagccgttcatctttgcattgatctgcgatgtgatcggc
gcaaccggcgcgcgtgagcggattggcgtcaatgcgaccggctacgcattcaactctatt
gccggcatcgagcgcaacgcggaaggacgcagcaatccgatggtcaatgtctgcgctcga
gctccagatgctgcgtcgtcagcacgatga

DBGET integrated database retrieval system