KEGG   Sinorhizobium fredii USDA 257: USDA257_c52780Help
Entry
USDA257_c52780    CDS       T02188                                 

Gene name
exoN2
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase ExoN
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00040  Pentose and glucuronate interconversions
sfd00052  Galactose metabolism
sfd00500  Starch and sucrose metabolism
sfd00520  Amino sugar and nucleotide sugar metabolism
sfd01100  Metabolic pathways
sfd01130  Biosynthesis of antibiotics
Module
sfd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    USDA257_c52780 (exoN2)
   00052 Galactose metabolism
    USDA257_c52780 (exoN2)
   00500 Starch and sucrose metabolism
    USDA257_c52780 (exoN2)
   00520 Amino sugar and nucleotide sugar metabolism
    USDA257_c52780 (exoN2)
Enzymes [BR:sfd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     USDA257_c52780 (exoN2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFL53803
UniProt: I3XD47
Position
complement(5472430..5473317)
Genome map
AA seq 295 aa AA seqDB search
MTEKRKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPVIQYVVDEALEAGIEHLIFVT
GRSKAVIEDYFDIQVELDQTLRERNKKAEIELLEAMLPQAGTTSFTRQQAPLGLGHAVWC
ARELVGNEPFALLLPDMIMKGEKGCLKGMVELYEHSGGNVIAVEECAPDQAHKYGIVGVG
DTVGDGFKITKMVEKPAPGTAPSNFFINGRYILQPEIFPILERQERGAGNEIQLTDGMVK
LAEAQPFAAYHFRGETFDCGAKDGFILANVAFALERADIRPTVEGPLRSLLQGLK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaagcgtaaagtccgcaaagccgtgttccccgttgcaggcctggggacgcgt
tttcttcccgccaccaaggcggtgccgaaggaaatgctgacggtggtggacaagccggtc
atccagtatgtcgtcgacgaagcactggaagcggggatcgagcatctgatcttcgtgacc
ggtcgcagcaaggcggtcatcgaggattatttcgacatccaggtcgagctcgaccagacg
ctgcgcgagcgcaacaagaaggcggagatcgagctgctcgaagccatgctgccgcaggcc
ggcacaacgagcttcacccgccagcaggcgccgctcggcctcggccacgcggtatggtgc
gcgcgtgaactcgtcggcaacgagcctttcgcgctgcttctgcccgacatgatcatgaag
ggcgagaagggttgcctcaagggcatggtcgagctttacgagcacagcggcggcaatgtc
atcgccgtcgaggagtgcgcccccgaccaggcgcacaaatacggcatcgtcggcgtcggc
gacacggtcggcgacggtttcaagattaccaaaatggtcgagaagccggcccccggcacg
gcgccgtccaacttcttcatcaacggccgctatatcctgcagccggaaatcttcccgatt
ctcgagcggcaggaacgcggcgccggcaacgagatccagttgaccgacggcatggtgaag
cttgccgaggcgcagcctttcgccgcctatcatttccgcggcgagactttcgactgcggg
gcgaaagacggctttatcctcgccaatgtcgccttcgcgctcgagcgcgccgatattcgt
cccacggtcgaagggccgctcaggtcgctgctacaaggattgaagtga

DBGET integrated database retrieval system