KEGG   Sinorhizobium fredii USDA 257: USDA257_c52850Help
Entry
USDA257_c52850    CDS       T02188                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    USDA257_c52850 (pldB)
Enzymes [BR:sfd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     USDA257_c52850 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5485295..5486278
Genome map
AA seq 327 aa AA seqDB search
MTTILQSTPDNPIPGKPQVGFFDGAGDRKIRYAVFKANAPVTRGTIVLLQGRNESIEKYF
ETIGDLMAAGFWVATFDWRGQGGSERLLPQLGRGHVEHFADYERDLTIFLEQIVLPDTRL
PFSIVAHSMGALVALSLAPMLASRIDRMVLLAPFLGLRGQAIGEHGIVAIATAMRWFGLG
SLPVRGDTEGRTPFDNNPLTTDSRRYARNLALIDAHPHLRIGPPTGRWLSESFRVIRRAM
RREHLTKIIVPTVILAPTADALVPYLAMEFLASNFRAGHLIPIDGARHELFQEADRYRAQ
ALAAILAFLPEANDEDADPSPRTMEDA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatccttcaatccacgccggacaatccgataccgggaaagccccaggtgggc
tttttcgacggcgccggcgatcgcaagattcgttatgcggtgttcaaggcgaacgcgccg
gtcacgcgcggcacgatcgtgctgctgcaggggcgcaacgagtcgatcgagaaatacttc
gaaacgatcggcgacctcatggcggcaggattttgggtcgccactttcgactggcgcggc
cagggtgggtccgaacggctgttgccacagctgggccgtggccacgtggagcattttgcc
gattacgagcgcgacctcacgatattcctcgagcagatcgtcctgcctgacacgcgcctg
cccttctccatcgtcgcccattcaatgggggcgctcgtcgccctgtcgctggcgccgatg
ctggcaagccgcatcgaccgcatggtgctgctcgcccccttcctgggcttgaggggccag
gcgatcggcgagcacggcatcgtggcgatcgccaccgccatgcgctggttcggcctcggc
agcctgccggtgcgcggcgacaccgagggtcggacgccgttcgacaacaatccgctgacc
accgacagccgacgctatgcgcgcaacctggctttgatcgacgcccatcctcatttgcgg
atcggaccaccgacgggccggtggctcagcgagtcgttccgggtgatcaggcgcgccatg
cgccgcgaacacctgacgaagatcatcgtcccgaccgtcatcctggcgccgacggccgac
gctctcgtgccctatctcgcgatggagttcctcgccagcaatttccgggccggccacctg
ataccgatcgacggcgcgcgccacgagctcttccaggaggccgaccgctaccgcgctcag
gcactcgccgcaattctggccttcctgccggaggcgaatgacgaggacgccgatccttcg
ccgcgcaccatggaggatgcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system