KEGG   Sinorhizobium fredii USDA 257: USDA257_c55310Help
Entry
USDA257_c55310    CDS       T02188                                 

Gene name
arcB3
Definition
arginase ArcB (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    USDA257_c55310 (arcB3)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    USDA257_c55310 (arcB3)
Enzymes [BR:sfd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     USDA257_c55310 (arcB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5743921..5744844
Genome map
AA seq 307 aa AA seqDB search
MKTITLIGAPIEEGSGRRGAAMGPTALRIAGIDTVLAELGHTVHDEGDLRPLPARDLPNH
PGANNLQMVAAFARALNDAVHDTALEGHFPIILGGDHALSMGSVSGMARYADEVGRPLFV
LWLDAHADFNSPSTSPSGNMHGMPVAFFCGEAEFTPILAPNRPLVDPKKVYQVGIRSVDA
REREEIAEHGVNVYDMRAVDEIGMAHIMHQILDEVRAANGLLHVSLDVDFMDPEFAPGVG
TTVPGGATFREAHLIMEMLCDSGLVSSLDVVELNPFLDDRGKSARILVELTASLFGRRIL
DRPTRSA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccatcacgttgatcggtgcaccgatcgaggaaggttccggacgccgcggcgcg
gccatgggcccgacggcgctcaggattgccggcatcgatacggtcctcgccgaactgggc
catacggttcacgacgaaggcgacctgcgaccgttaccggcgcgcgacctcccgaaccat
ccgggcgccaataatctgcagatggtcgccgcctttgcccgggccctcaacgacgcggtg
cacgacaccgccctcgaggggcattttccgatcattctcggcggcgaccacgccctctcg
atgggcagcgtctccggcatggcgcgctacgcggacgaagtcggccggccgctcttcgtg
ctgtggctcgacgcccatgcggattttaactcgccatcgacctcgccatccggcaacatg
cacggcatgccggtcgcctttttctgcggcgaggcggaattcaccccgatccttgccccc
aaccggccgctcgtcgatccgaaaaaggtctaccaggtcggcattcgttccgtcgatgca
cgcgagcgcgaggagatcgccgaacacggcgtcaatgtctatgacatgcgcgccgtcgac
gagatcggcatggcccatatcatgcatcagatcctcgacgaggtgcgcgccgccaacggc
ctcttgcacgtgagcctcgacgtcgatttcatggatccggagtttgcccccggcgtcggc
accaccgttccgggtggcgccaccttccgcgaggcccatctcatcatggagatgctctgc
gacagcggcctcgtctcctcgctcgatgtcgtcgaactcaacccgttcctcgacgaccgc
ggcaagagcgcccgcatcctggtggagctgacggcgagcctcttcggccgtcgcatcctt
gaccgtccgacccggagcgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system