KEGG   Sinorhizobium fredii USDA 257: USDA257_c55310Help
Entry
USDA257_c55310    CDS       T02188                                 

Gene name
arcB3
Definition
arginase ArcB (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sfd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sfd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5743921..5744844
Genome map
AA seq 307 aa AA seqDB search
MKTITLIGAPIEEGSGRRGAAMGPTALRIAGIDTVLAELGHTVHDEGDLRPLPARDLPNH
PGANNLQMVAAFARALNDAVHDTALEGHFPIILGGDHALSMGSVSGMARYADEVGRPLFV
LWLDAHADFNSPSTSPSGNMHGMPVAFFCGEAEFTPILAPNRPLVDPKKVYQVGIRSVDA
REREEIAEHGVNVYDMRAVDEIGMAHIMHQILDEVRAANGLLHVSLDVDFMDPEFAPGVG
TTVPGGATFREAHLIMEMLCDSGLVSSLDVVELNPFLDDRGKSARILVELTASLFGRRIL
DRPTRSA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccatcacgttgatcggtgcaccgatcgaggaaggttccggacgccgcggcgcg
gccatgggcccgacggcgctcaggattgccggcatcgatacggtcctcgccgaactgggc
catacggttcacgacgaaggcgacctgcgaccgttaccggcgcgcgacctcccgaaccat
ccgggcgccaataatctgcagatggtcgccgcctttgcccgggccctcaacgacgcggtg
cacgacaccgccctcgaggggcattttccgatcattctcggcggcgaccacgccctctcg
atgggcagcgtctccggcatggcgcgctacgcggacgaagtcggccggccgctcttcgtg
ctgtggctcgacgcccatgcggattttaactcgccatcgacctcgccatccggcaacatg
cacggcatgccggtcgcctttttctgcggcgaggcggaattcaccccgatccttgccccc
aaccggccgctcgtcgatccgaaaaaggtctaccaggtcggcattcgttccgtcgatgca
cgcgagcgcgaggagatcgccgaacacggcgtcaatgtctatgacatgcgcgccgtcgac
gagatcggcatggcccatatcatgcatcagatcctcgacgaggtgcgcgccgccaacggc
ctcttgcacgtgagcctcgacgtcgatttcatggatccggagtttgcccccggcgtcggc
accaccgttccgggtggcgccaccttccgcgaggcccatctcatcatggagatgctctgc
gacagcggcctcgtctcctcgctcgatgtcgtcgaactcaacccgttcctcgacgaccgc
ggcaagagcgcccgcatcctggtggagctgacggcgagcctcttcggccgtcgcatcctt
gaccgtccgacccggagcgcctga

DBGET integrated database retrieval system