KEGG   Sinorhizobium fredii USDA 257: USDA257_c55310Help
Entry
USDA257_c55310    CDS       T02188                                 

Gene name
arcB3
Definition
(GenBank) arginase ArcB
  KO
K01476  arginase [EC:3.5.3.1]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00220  Arginine biosynthesis
sfd00330  Arginine and proline metabolism
sfd01100  Metabolic pathways
sfd01110  Biosynthesis of secondary metabolites
sfd01130  Biosynthesis of antibiotics
sfd01230  Biosynthesis of amino acids
Module
sfd_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    USDA257_c55310 (arcB3)
   00330 Arginine and proline metabolism
    USDA257_c55310 (arcB3)
Enzymes [BR:sfd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     USDA257_c55310 (arcB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFL54046
UniProt: I3XDU0
Position
5743921..5744844
Genome map
AA seq 307 aa AA seqDB search
MKTITLIGAPIEEGSGRRGAAMGPTALRIAGIDTVLAELGHTVHDEGDLRPLPARDLPNH
PGANNLQMVAAFARALNDAVHDTALEGHFPIILGGDHALSMGSVSGMARYADEVGRPLFV
LWLDAHADFNSPSTSPSGNMHGMPVAFFCGEAEFTPILAPNRPLVDPKKVYQVGIRSVDA
REREEIAEHGVNVYDMRAVDEIGMAHIMHQILDEVRAANGLLHVSLDVDFMDPEFAPGVG
TTVPGGATFREAHLIMEMLCDSGLVSSLDVVELNPFLDDRGKSARILVELTASLFGRRIL
DRPTRSA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccatcacgttgatcggtgcaccgatcgaggaaggttccggacgccgcggcgcg
gccatgggcccgacggcgctcaggattgccggcatcgatacggtcctcgccgaactgggc
catacggttcacgacgaaggcgacctgcgaccgttaccggcgcgcgacctcccgaaccat
ccgggcgccaataatctgcagatggtcgccgcctttgcccgggccctcaacgacgcggtg
cacgacaccgccctcgaggggcattttccgatcattctcggcggcgaccacgccctctcg
atgggcagcgtctccggcatggcgcgctacgcggacgaagtcggccggccgctcttcgtg
ctgtggctcgacgcccatgcggattttaactcgccatcgacctcgccatccggcaacatg
cacggcatgccggtcgcctttttctgcggcgaggcggaattcaccccgatccttgccccc
aaccggccgctcgtcgatccgaaaaaggtctaccaggtcggcattcgttccgtcgatgca
cgcgagcgcgaggagatcgccgaacacggcgtcaatgtctatgacatgcgcgccgtcgac
gagatcggcatggcccatatcatgcatcagatcctcgacgaggtgcgcgccgccaacggc
ctcttgcacgtgagcctcgacgtcgatttcatggatccggagtttgcccccggcgtcggc
accaccgttccgggtggcgccaccttccgcgaggcccatctcatcatggagatgctctgc
gacagcggcctcgtctcctcgctcgatgtcgtcgaactcaacccgttcctcgacgaccgc
ggcaagagcgcccgcatcctggtggagctgacggcgagcctcttcggccgtcgcatcctt
gaccgtccgacccggagcgcctga

DBGET integrated database retrieval system