KEGG   Sinorhizobium fredii USDA 257: USDA257_c55760Help
Entry
USDA257_c55760    CDS       T02188                                 

Gene name
sucB2
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00020  Citrate cycle (TCA cycle)
sfd00310  Lysine degradation
sfd01100  Metabolic pathways
sfd01110  Biosynthesis of secondary metabolites
sfd01120  Microbial metabolism in diverse environments
sfd01130  Biosynthesis of antibiotics
sfd01200  Carbon metabolism
Module
sfd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    USDA257_c55760 (sucB2)
  Amino acid metabolism
   00310 Lysine degradation
    USDA257_c55760 (sucB2)
Enzymes [BR:sfd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     USDA257_c55760 (sucB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Fim-adh_lectin
Motif
Other DBs
NCBI-ProteinID: AFL54091
UniProt: I3XDY5
Position
complement(5789239..5790555)
Genome map
AA seq 438 aa AA seqDB search
MRWGADQVPRRLPIDRNRYLINGTKIMATEIRVPTLGESVSEATVGTWFKKVGDAIKADE
PILELETDKVTIEVPAPSAGTLSEIVAQAGETVGLGALLGQIAEGAGAAAAAPAPAEKKA
EPAAAAPAAKPAAAAPQAQSSMPPAPAAAKLIAENNLSADQLDGSGKRGQVLKGDVLAAV
VKGISAPAAAEPAKIQARAPAPAEDAVREERVKMTRLRQTIARRLKDAQNTAAMLTTYNE
VDMSAVMSLRNRYKDIFEKKHGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDIIYKNFC
HVGVAVGTDKGLVVPVVRDADQMSIAEIEKEIGRLGKAARDGTLSMADMQGGTFTISNGG
VYGSLMSSPILNAPQSGILGMHKIQDRPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTF
LVRVKDSLEDPERLVLDL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggggggctgatcaagtccctcgccgcctgccaatcgacagaaacagatatctg
atcaacggaacaaaaatcatggcaacagaaatccgcgttcctaccctcggcgaatccgtc
agcgaagcgaccgtcgggacctggttcaagaaggtcggcgatgcgatcaaggccgacgaa
ccgatcctcgagctcgagaccgacaaggtgacgatcgaagtgccggcgccgtccgccggc
acgctcagcgaaatcgtcgcgcaggcgggtgagaccgtcggtctcggcgcgttgctcggc
cagatcgccgaaggcgcgggtgccgccgcagccgctccggcgccggccgagaagaaggcc
gagcccgctgccgctgctcccgccgcgaagccggcagccgccgcaccgcaggctcagtcc
tccatgccgccggctccggcggccgccaagctcatcgccgaaaacaatctttccgccgac
cagctcgacggttccggcaagcgcggccaggtgctgaagggcgatgtgctcgccgctgtc
gtcaagggaatttcggcgcccgcagccgccgaaccggccaagatccaggcccgtgcgccg
gcgccggcagaagacgccgtccgcgaagagcgcgtcaagatgacccgcctgcgtcagacg
atcgcccggcgtctcaaggacgcgcagaacaccgccgcgatgctcaccacctacaacgag
gtggacatgagcgccgtcatgagcctgcgaaacaggtacaaggacatcttcgagaagaag
cacggcgtgaagctcggcttcatgggcttcttcaccaaggccgtcacgcatgctctgaag
gagctgccggctgtcaacgccgagatcgacggcaccgacatcatctacaagaacttctgc
catgtcggcgtggccgtcggcaccgacaagggccttgtcgtgccagtcgtgcgggatgcc
gaccagatgtcgattgccgaaatcgagaaggaaatcggccgtctcggcaaggcggcacgc
gacggaacgctgtcgatggccgacatgcagggcggcaccttcaccatctccaacggtggc
gtctacggttcgctgatgtcctcgccgatcctcaatgcgccgcagtcgggcatcctcggc
atgcacaagatccaggaccgcccggtcgcgatcggcggccaggttgtcatccgtccgatg
atgtatctggcgctctcctacgatcaccgcatcgtcgatggcaaggaagccgtgaccttc
ctggtgcgcgtcaaggacagcctcgaggatccggaacgtctggtgctcgacctctaa

DBGET integrated database retrieval system